KEGG   Azospirillum lipoferum: AZOLI_p10101Help
Entry
AZOLI_p10101      CDS       T01658                                 

Gene name
treS
Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ali  Azospirillum lipoferum
Pathway
ali00500  Starch and sucrose metabolism
ali01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZOLI_p10101 (treS)
Enzymes [BR:ali01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AZOLI_p10101 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AZOLI_p10101 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: CBS88419
UniProt: G7ZB39
LinkDB All DBs
Position
AZO_p1:104961..108338
Genome map
AA seq 1125 aa AA seqDB search
MIDRQDRLWYKDAVIYQLHIKAFFDADNDGIGDFAGLTQKLDYIQELGVTAVWLLPFYPS
PLRDDGYDIADYTSVNPTYGNLDDFRHFMEECHNRGLRVITELVINHTSDQHPWFQRARE
APPGSNHRDYYVWSDSDQKYQGTRIIFCDTEKSNWTWDPVANAYYWHRFYSHQPDLNFDN
PEVLEEVLKVMRFWLDIGVDGLRLDAIPYLKEREGTNNENLPETHDVLKAIRAALDAEYP
DRMLLAEANQWPEDVLPYFGDPAKGGDECHMSFHFPLMPRIYMAVAMEDRHPIADIMRQT
PDIPADCQWAIFLRNHDELTLEMVTDSERDYLWNFYAADRRMRINLGIRRRLAPLLENDR
RKIELLNSLLMSMPGTPVLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGGFSRADPAR
LYLPAVLDPIYGFMAVNVEAQARNPSSLLNWMKRLVAVRKQRQSFGRGSFSLLYPGNRKV
LAYVRCLETENGLEIALCVANLSRSAQAVELDLKNWKGRIPVELLGRTVFPPIGDLPYLL
TLPAYGFYWFALTAEAELPTWHETPPEPVPDLLTVVVRDGWHSLTSGKAADELGRDILQA
FLPQQRWFSAKDRRITRSHVTMAAQLPGPGDGFMLVRTQVGLSGVGGDGDAADQSYFLPM
AMSWESGAGGTGWPLLPYTLAKVRRGPRTGAIYDAVQADGFALALIEALRRGETLQAMSG
QWMAGSGSIRFTATDALAAIDLSEEAEVRRLGVEQSNTSVLVDSQIVLKVLRRLVEGEHP
EVEMGRFLTEVGFANTPALLGTVEQVAADGTPTALAVAQAFVRNQGDGWASTVEELERQL
EDIRLGVAGTTEDAAESGEPFGMHLVMMTTLGQRTAELHRALAQATGKPAFDPEPITPDD
LARWADAARAQAEAAFAALPGTLDRLPANVSGDAEQLLARRAEAMGRLDALAGMRIDGVK
TRIHGDYHLGQVVRAQNDWYILDFEGEPAKTLEERRAKSSPLRDVAGMLRSFNYAAWAAL
FRLDSAGEGANSGDSPALAAALDWERRSIDSFLDGYRTAIEGCPVWPAGNGTGDEAARGL
LTLFLLEKAFYEIGYEAANRPSWIGIPVKGVLGLLDDADEAGAKG
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcggcaggaccggctctggtacaaggacgccgtcatctaccaactgcacatc
aaggcgttcttcgacgccgacaatgacggcatcggcgatttcgccggcctgacccagaag
ctggactacatccaggagctgggggtgacggcggtgtggcttctgcccttctatccgtcc
ccgttgcgcgatgacggctatgacatcgccgactacacctcggtcaacccgacctacggg
aacctggacgacttccggcatttcatggaggaatgccacaaccgcggcctcagggtgatc
accgagctggtcatcaaccacacctccgaccagcatccctggttccagcgcgcgcgggag
gcgcctcccggctccaaccaccgcgactattatgtctggtccgacagcgaccagaaatac
cagggcacgcgcatcatcttctgcgacacggaaaagtccaactggacctgggatccggtc
gccaacgcctattactggcatcgcttctattcgcaccagcccgacctgaacttcgacaat
cccgaggttctggaggaggtgctgaaggtgatgcgcttctggctggacatcggggtggat
gggttgcggctcgacgccatcccctacctgaaggagcgcgagggcaccaacaacgagaat
ctgccggagacgcacgacgtcctgaaggcgatccgcgccgcgctggatgccgaatacccc
gaccgcatgctgctggccgaggccaaccagtggccggaggacgtgctgccctatttcggc
gatcctgcgaagggcggcgacgaatgccacatgtccttccacttcccgctgatgccgcgc
atctacatggcggtggcgatggaggaccggcatcccatcgccgacatcatgcgccagacc
ccggacatcccggccgactgccaatgggccatcttcctgcgcaaccatgacgaactgacg
ctggagatggtcaccgacagcgagcgcgactatctctggaacttctacgccgccgaccgg
cgcatgcggatcaatctcggcatccgccgccgtctcgctcccctgctggagaacgaccgc
cgcaagatcgagctgctgaacagcctcctgatgtcgatgcccggcacgccggtgctgtat
tacggcgacgagatcggcatgggcgacaacatctatctcggcgaccgcgacggcgtgcgc
acgccgatgcaatggtccatcgaccgcaacggcggcttctcgcgcgccgacccggcccgg
ctctatctgccggcggtgctcgacccgatctatggcttcatggccgtcaatgtggaggcg
caggcccgcaacccctcctcgctgctgaactggatgaagcggctggtggcggtgcgcaag
cagcgccagagcttcggccgcggcagcttctcgctgctctatcccggcaaccgcaaggtc
ctggcctatgtccgctgcctggagacggaaaacgggttggagatcgcgctgtgcgtcgcc
aacctgtcgcgctcggcccaggcggttgagctggacctgaagaattggaaaggccgcatc
ccggtcgagcttctgggccgcaccgtcttcccgccgattggcgaccttccctatctgctg
accctgccggcctacggcttctactggttcgccctgaccgcggaggcggagctgccgacc
tggcacgaaaccccgccggagccggtgccggacctgctgaccgtggtcgtccgcgacggc
tggcacagcctgaccagcggcaaggcggcggacgagctgggccgcgatatcctgcaggcc
ttcctgccgcagcagcgctggttctccgccaaggaccgccgcatcacccgctcgcatgtc
accatggccgcccagctgccgggaccgggcgacggtttcatgctggtcaggacgcaggtc
ggcctcagtggggttgggggggacggcgatgccgccgaccagagctatttcctgccgatg
gcgatgagctgggagagcggggcgggcggcaccggctggccgctgcttccctacacgctg
gcgaaggtgcggcggggtcccaggaccggcgccatctatgacgcggtgcaggccgacggc
ttcgcgctcgccctgatcgaggctctcaggcgtggcgaaacgctgcaggcgatgtcgggg
cagtggatggccggcagcggcagcatccgcttcaccgccaccgacgcgctggccgccatc
gacctgtcggaggaagccgaggtgcggcggctgggcgtggagcagagcaacacctccgtc
ctggtcgacagccagatcgtgctgaaggtgctgcgccggctggtggagggcgagcatccg
gaggtcgagatgggccgcttcctgacggaggtcggcttcgccaacaccccggccctgctg
ggcaccgtggagcaggtggcggccgacggcacgcccaccgcgctggcggtggcgcaggcc
ttcgtccgcaaccagggcgacggctgggccagtacggtggaggagctggaacgccagctg
gaggacatccgcctcggcgtcgccggcaccaccgaggacgccgccgaatcgggcgagcct
ttcggcatgcatctggtgatgatgaccacgctggggcagcgcaccgccgaactgcaccgg
gcgctggcccaggccaccggcaagccggccttcgatccggagccgatcacgcccgacgat
ctggcccgctgggccgatgccgcccgcgcccaggcggaggcggccttcgccgccctgccc
ggaacgctggaccgtctgccggccaatgtgagcggcgatgccgaacagcttctggcccgc
cgggccgaagcgatggggcggctcgacgcgctggcggggatgcggatcgacggcgtcaag
acccgcatccacggcgactatcacctgggtcaggtcgttcgggcgcagaacgactggtac
atcctggacttcgagggcgagccggcgaagacgctggaggaacgccgcgccaagtccagc
ccgctgcgcgacgtggccggcatgctgcgctccttcaactatgccgcctgggcggcgttg
ttccggctggacagcgcgggcgagggcgccaacagcggtgacagcccggcgctggccgcc
gccctcgactgggaacgccgcagcatcgactccttcctcgacggctaccgcacggccatc
gagggctgcccggtctggccggcggggaatgggaccggcgacgaggctgcgcgcggcctg
ctgaccctgttcctgctggaaaaggccttctacgagatcggctacgaggcggcgaaccgg
cccagctggatcggcatcccggtcaagggcgtgctgggcctgctcgacgatgccgatgag
gcgggcgcgaaggggtga

DBGET integrated database retrieval system