KEGG   Austrofundulus limnaeus (annual killifish): 106523541
Entry
106523541         CDS       T06063                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04012  ErbB signaling pathway
alim04068  FoxO signaling pathway
alim04110  Cell cycle
alim04115  p53 signaling pathway
alim04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106523541
   04068 FoxO signaling pathway
    106523541
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106523541
   04115 p53 signaling pathway
    106523541
   04218 Cellular senescence
    106523541
SSDB
Motif
Pfam: CDI m04gp34like
Other DBs
NCBI-GeneID: 106523541
NCBI-ProteinID: XP_013872437
UniProt: A0A2I4BXH4
LinkDB
Position
Unknown
AA seq 164 aa
MMSSGRRGSVCRSLFGPADHDQLRQDLELKLQEITEQDSQXWNFSFQSDTPLSGRFEWEV
ISTEWGAACTLQLCSKTQREEMCDKQECLTGTDQENCSSISNAPRSPAEGSPIQMKRSKY
EAEPRTNTQITDFFTKKRRSTETRSTTKSSHSRSSEAAQCRTLG
NT seq 495 nt   +upstreamnt  +downstreamnt
atgatgagcagcggacgcagaggttctgtttgcaggagcctctttggcccggctgaccac
gaccagctgcgccaggacttggagctgaagctgcaggagatcacagagcaggacagccag
crctggaacttcagcttccagtctgacacgccgctgagtggcaggtttgagtgggaagta
atatcgacagagtggggagctgcctgcactcttcagctgtgctcaaagacccagcgtgag
gaaatgtgtgacaaacaggagtgcctgactggcaccgaccaggagaactgctccagcatc
tctaacgccccaaggagtcctgctgaggggagccccatccagatgaagaggtccaaatat
gaagcagagcccagaaccaacacacaaattacagattttttcactaagaaaaggaggtcg
acagaaaccagaagtactaccaagtcttctcacagcagatccagtgaagcagctcagtgc
agaacattgggatga

DBGET integrated database retrieval system