Algoriphagus sanaruensis: AO498_03835 Help Entry AO498_03835       CDS       T04334                                  Name (GenBank) ATP synthase subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism alm  Algoriphagus sanaruensis Pathway alm00190   Oxidative phosphorylation alm01100   Metabolic pathways Module alm_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:alm00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AO498_03835  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:alm00194]     AO498_03835 Photosynthesis proteins [BR:alm00194]  Photosystem and electron transport system   F-type ATPase [OT]    AO498_03835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  AMQ55520 UniProt:  A0A142EK65 LinkDB All DBs Position complement(863321..863566) Genome browser AA seq 81 aa AA seqDB search MQLEIVTPDKKVFQGEVTEATFPGASGAFQVLNNHAPIVSALAKGAVSFTTKEGKQSMIV DGGVVEVKNNVIVVLAEKVVS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcaactagagatcgtcacaccggacaaaaaagtatttcagggagaagtcactgaggcc actttcccaggagcttctggtgctttccaagtgctgaataatcacgctccgatcgtatct gctttggcaaagggcgcagtttcctttacaaccaaagaaggtaaacaatccatgattgtg gacggaggagttgtagaagtgaagaataatgtgattgtagtcttagctgaaaaagtagtc agttaa

DBGET integrated database retrieval system