KEGG   Alteromonas macleodii ATCC 27126: MASE_08195Help
Entry
MASE_08195        CDS       T02246                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
amac  Alteromonas macleodii ATCC 27126
Brite
KEGG Orthology (KO) [BR:amac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MASE_08195
Enzymes [BR:amac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MASE_08195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like FAD_binding_2 GIDA DAO FAD_oxidored Lycopene_cycl Thi4 AlaDh_PNT_C Thioredoxin_9 ABC_transp_aux NAD_binding_8 Glutaredoxin Thioredoxin_4 K_oxygenase 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFS37170
LinkDB All DBs
Position
1927211..1928800
Genome map
AA seq 529 aa AA seqDB search
MLTKEILQALKSYAESMQKNVTFVVQTGEHSKREELVTFLSDIASVSEKLNVEERDTNGE
LRSAISFLLEADGEDTGIRFSGIPGGHEFNSLVLAMLHAAGTELKLDDSVKSMVKAVNEP
LNFEVFISLSCHNCPEVVQALNQFALINPNIKTEMIDGGLYQNLIQERDIQGVPSVYLNG
ELFANGKVDASVLINKLIERDPSLKEANKGGALPLQDVTVIGGGPAGVASAIYSARKGLK
VAIVAETFGGQVKDTMGIENLISVPKTTGPELVGNLMEHVRDYDITLKEHVRVDSIEKGN
IKTITLSSGEQIRTRTVIVATGARWRELGVPGEKENIGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPELKADKVLIDQAQKRDNITIIKNAATRQITAEN
GKVNAIEYQDRSTNEVHTRELAGVFVQIGLVPNSQFMKGTVDMTQYGEIIVDTKCHTSEP
GIFAAGDVTTVPYKQIVISMGEGAKASLAAFEYLLSHEVVESEQESEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttacaagcattgaaatcatatgcagagtcaatgcaaaaaaac
gtaacctttgtcgtacagaccggtgaacatagcaagcgtgaagagcttgtgacgtttctg
tccgacattgcttcagtaagcgaaaaattaaacgtagaagagcgtgacacaaatggtgag
ttgcgcagtgcaatcagctttttgttggaagctgacggcgaagatacgggaattcgtttt
tctggtatccctggcggtcacgagtttaactcgcttgtacttgccatgctgcatgcagcg
ggtactgaacttaagctagacgatagcgttaagtcgatggtgaaagcggtgaatgaacca
cttaattttgaagtgttcattagcttaagctgtcacaactgccctgaagtcgtacaggca
cttaatcaatttgctttgattaatcctaacatcaagaccgaaatgatcgacggcgggtta
tatcaaaatctaattcaagagcgcgacatccaaggtgttcctagcgtataccttaatggc
gagctattcgcgaatggtaaagttgatgcctctgtgcttatcaacaagttaattgaacgc
gaccctagccttaaagaagcaaacaaaggcggtgcgttaccacttcaagacgtaacggtt
atcggtggtggtccagcaggcgttgcttcggcgatttacagtgcccgtaaaggccttaaa
gttgccattgttgctgaaacttttggcggccaagttaaagataccatgggtatcgagaat
cttatctcagtacctaaaacaacgggccctgagcttgttggtaacttgatggagcacgta
cgcgattacgacataacgcttaaagagcacgtacgtgttgatagcattgagaaaggcaac
attaaaaccattacgctttcttctggcgaacagatccgcactcgtacggttattgttgcg
acaggcgcacgctggagagaacttggtgttccgggcgaaaaagagaacatcggtaatggt
gttgcatactgcccacactgcgacggccctttcttcaaaggtaaagacgtagcggtcatt
ggcggtggtaactcaggtattgaagcagcacttgaccttgcaggcattgtaaaatcggtg
acggtatttgaatttatgccagaactaaaagcggataaggtacttatcgatcaagctcaa
aagcgcgataatattaccattatcaagaacgcggcaacgcgccaaattactgctgaaaat
ggcaaagtaaacgcaattgaataccaagatcgctcaactaacgaagtgcacacccgtgaa
cttgcaggtgtatttgttcaaattggacttgtaccaaacagtcagtttatgaagggcacg
gtagacatgacgcagtatggcgaaattattgttgatactaagtgtcatacatctgagccg
ggtatatttgcagccggtgacgtaacaacagtaccgtataagcaaattgttatttcgatg
ggcgagggcgcgaaagcatcgcttgctgcatttgaatacttattaagccatgaagtagtt
gagtctgaacaggaaagtgaagcggcatag

DBGET integrated database retrieval system