KEGG   Alteromonas mediterranea UM7: I635_09345Help
Entry
I635_09345        CDS       T02724                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
amai  Alteromonas mediterranea UM7
Brite
KEGG Orthology (KO) [BR:amai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    I635_09345
Enzymes [BR:amai01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     I635_09345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 HI0933_like GIDA DAO FAD_oxidored Lycopene_cycl Thi4 AlaDh_PNT_C Thioredoxin_9 NAD_binding_8 Glutaredoxin ABC_transp_aux Thioredoxin_4 K_oxygenase 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGP97393
UniProt: S5C8Y4
LinkDB All DBs
Position
2081037..2082626
Genome map
AA seq 529 aa AA seqDB search
MLTKEILQALKSYAETMQKNVTFVVQTGEHSKRDELVKFLSDIASVSEKLNVEERDTNGE
LRSAISFLLEADGEDTGIRFSGIPGGHEFNSLVLAMLHAAGTELKLDDSVKAMVKAINEP
LNFEVFISLSCHNCPEVVQALNQFALVNPNIKAEMIDGGLYQNLIQERDIQGVPSVYLNG
ELFANGKVDASVLINKLIERDPSLKEANKGDALPLQDVTVIGGGPAGVASAIYSARKGLK
VAIVAETFGGQVKDTMGIENLISVPKTTGPELVGNLMEHVRDYDITLKEHVRVDSIEKGN
IKTITLSSGEQIRTRTVIVATGARWRELGVPGERENVGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPELKADQVLIDQAEKRDNITIIKNAATRQITAEN
GKVNAIEYQDRSTNEIHTRELAGVFVQIGLVPNSQFMKDTVEMTQYGEIVVDNKCHTSEP
GIFAAGDVTTVPYKQIVISMGEGAKASLAAFEYLLSHEVVESEDESEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttacaagcattgaagtcttatgctgaaacaatgcaaaaaaac
gtaacctttgtcgtacagaccggtgaacatagcaagcgcgacgagcttgtgaagtttctg
tccgacattgcatcagtaagcgaaaaacttaatgttgaagagcgcgacactaatggtgaa
ctccgcagcgctatcagcttcctattagaagctgacggtgaagatacgggtatccgtttc
tcaggcattcccggtggtcacgaattcaactctttagtccttgccatgctgcacgcagca
ggcacagaactgaagctagatgacagcgttaaagcgatggtaaaagctatcaatgaaccg
cttaacttcgaagtgttcattagccttagctgtcacaactgcccagaggtcgttcaggcg
ttaaaccaatttgcattggttaatccaaatattaaagctgaaatgattgatggcggttta
tatcaaaacttaattcaagagcgcgacattcaaggtgtaccaagtgtgtatctaaatggc
gagctattcgcaaacggtaaagttgacgcttctgtgcttatcaacaaacttatcgaacgc
gacccaagccttaaagaagcgaataaaggcgacgcgttaccgctgcaagatgtgacggta
attggcggtggcccagctggcgtagcatcagctatctacagcgctcgtaaaggtttgaaa
gtagcaattgttgcagaaacatttggcgggcaggttaaagatacgatgggcattgaaaac
ctaatctctgtgcctaaaaccacaggccctgaacttgttggcaacttgatggagcacgta
cgtgactacgacattacacttaaagagcatgttcgtgtagatagcatcgaaaaaggcaac
atcaaaacgattacgttgtcttctggcgagcaaatccgtacgcgtacggtaattgtcgct
actggtgcccgttggagagagctgggcgtaccaggtgaaagagaaaacgtagggaatggc
gtagcatattgcccacactgtgacggcccattctttaaaggcaaagacgtggcggtaatt
ggtggtggtaactcgggtattgaggctgcactagacctagcaggtatagtgaaatcggta
acggtatttgaattcatgccagagcttaaagccgatcaggtattaatagaccaagctgaa
aagcgcgacaatatcactattattaaaaatgcagcgacccgtcagatcactgcagaaaat
ggcaaagtgaatgcgattgagtaccaagaccgtagtactaacgagattcatacccgcgaa
ctagcaggtgtatttgttcaaattggtcttgttccaaacagccagttcatgaaagatacg
gttgaaatgacacaatacggcgagattgtggtagacaacaagtgtcatacatctgagcct
ggtatatttgcagcgggcgatgtaacaactgttccgtataagcaaattgttatttcaatg
ggcgagggcgctaaagcctcattggcagcgttcgagtatttactaagccacgaagtcgtt
gaatcagaagatgagagcgaagcagcttaa

DBGET integrated database retrieval system