KEGG   Alligator mississippiensis (American alligator): 102569824
Entry
102569824         CDS       T03087                                 

Gene name
FN1
Definition
(RefSeq) fibronectin 1
  KO
K05717  fibronectin 1
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04510  Focal adhesion
amj04512  ECM-receptor interaction
amj04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102569824 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102569824 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102569824 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:amj04131]
    102569824 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amj04147]
    102569824 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:amj00536]
    102569824 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:amj04990]
    102569824 (FN1)
Membrane trafficking [BR:amj04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    102569824 (FN1)
Exosome [BR:amj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   102569824 (FN1)
Glycosaminoglycan binding proteins [BR:amj00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   102569824 (FN1)
Domain-containing proteins not elsewhere classified [BR:amj04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   102569824 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 DUF4959 TILa Arylsulfotran_N
Other DBs
NCBI-GeneID: 102569824
NCBI-ProteinID: XP_006276492
LinkDB
Position
Un
AA seq 2384 aa
MPSSPAGQRLLLLLLFALCLGARCTERTAAKSRRQAQQVVQPPVPGTQSKQGCFDNGRHY
QINQQWERIYLGNTLVCTCYGGSRGFNCESKPEPEETCFDKYTGSTYRVGETYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPVAERCYDNNAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDHDTKTS
YRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLHTTSTGSGSSSFTDVRTALYQPQ
PQPQPYGQCITDNGVVYSVGMQWLKSQGSQQMLCTCLGNGVSCKEIAVTQTYGGNSNGEP
CVLPFTFDGRTFYSCTTEGRTDGQLWCSTTSDFVQDRKYSFCTEQNGLVQTRGGNSNGAL
CYFPFLYNNRNYTDCTSEGRRDNMKWCGTTPNYDADQKFGFCPMAAHEEACTTNEGVMYR
VGDQWDKQHDMGHMMRCTCMGNGRGEWTCIPYSQLRDQCIVDDITYDVNQTFHKRHEEGH
MLNCTCFGQGRGRWKCDPIDQCQDSETQTFYQIGDAWEKFLHNVRYQCYCYGLGIGEWHC
QPLQTYPGSTGPVQVIITESPNHPNSHPIQWNAPESSHISKYILRWKPKNSRVHWKEATI
PGHLNSYTISGLKPGVIYEGQLVSVQQYGLRELTRFDFTTAVISNTVVGETTPLTPMVAT
SESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGR
KYIVNVYQISEEGEQNLILSTSQTTAPDAPPEHTVESVDDTSIVVSWSRPQAPITGYRII
YAPSVEGSSTELNLPDTATSVTLSDLMPGVQYNISIYAVEENQESTPVFIQQETTGVPRA
DDIPSPRDLQFVEVSDVKITIMWTPPESTVSGYRVEVIPVHHPGEHGQRLPITRSSFAEV
IDLLPGTTYVFKIFAVSHGRESKPLTGEQTTKLDAPTNLRFINTTESSVLVTWTPPHAPI
SGYRLTIGPTRGGQPRNYNVGPSVIKYLLKSLQPGTEYTVYLVAVKGNQQSTRETGVFTT
LQPVGSIPLYHTEVTETSIVVTWTPAPRIGFKLGVRPSQGGEAPREVISESGSIVISGLT
PGVEYIYSISVLMDGEERENPIIKSVVTPLSPPATLHLEPNPDTGVLTVSWDRSTTPGIS
GYRITTAPTSGQQGYTLEEVVSAEQTYCTFENLSPGVEYNVSVYSVKGNQESIPISKTIT
QAVPAPTDLSFTSVGPDAMRVAWIPPTSIVLSSFLVRYSPVKNEEDVAELTISPTDRSVY
LQNLLPGTEYLVKVYSISEHHESVPLTGVQKTGIDSPMGIDFSDITANTFTVHWIAPRAT
ITGYRVRHQLEHGGGRPKEDRIPPSRNSITLTNLVPGSEYVVSIIAFNGREDSLPLVGQQ
STVSDVPQDLEVTPTSPTSLRISWDAPAVTVRYYRITYGETGGSSPVQEFTVPGTVSDAN
ISGLKPGVDYTITVYAVTGRGDSPASSKPVTVTYKIEINTPSQMQVTDVQDNSISVRWVP
SSSPVTGYRVTTVPKDGHGPTKTKTVPADQTEVTVEGLQPTVEYVISVYAQNQNGESEPL
SETTVTNIDRPKGLTFTEVDVDSIKIAWESPQGQVTSYRVTYSSPEDGIHELLPAPDGED
DTAELHGLRPGSEYTVSIVALHDDKESQPLTGTQSTAIPPPTNLNFVQVTPTSLMVTWNA
PNVRLTGYRVRVNPKEKTGPMKEINLSPDSTSAVVSGLMVATKYEVSVYALKDSLTSRPA
QGVITTLENVSPPRRARVGDVTETTISINWRTKTETITGFQVDAIPASGQNPIRRTIRPD
LRMYTITGLQPGTDYKIHLYALNDNARSSPVVIDASTNVDAPSNLQFLTTTSNSLLVTWQ
PPRAKITGYIIKYNKPGAQPKELLPRPRPGTTEATIIGLEPGTEYTIYIIAVKNNQKSEP
LIGRKKTDELPTLVTQTHPNQPEILDVPSIDERPPYFTNNRYDNGNGIQLPGTTGQQPSI
GHQGQQVFFEEHGFRRTTPPTTATPSRHRPRPQPPNVDETVELARYPIPHVVEPSYPHSR
GPRRNDTTGQEALSRTTISWRPLLESTEYLISCLPVGNDEETLQFRVPGTASSATLTGLT
RGATYNIIVEALKDHRRQKVLEEVVTVDNTVSEGLNQPTDDSCYDTYTGSFYSIGEEWER
LSETGFKLWCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGK
GEFKCEPHEATCYDDGKMYHVGEQWQKEYLGAICSCTCYGGQQGWRCDNCRRPNVDAASE
GSSGHTYTRFTQRYHQSTNTNVNCPIECFMPLDVQADTQHPRGQ
NT seq 7155 nt   +upstreamnt  +downstreamnt
atgcccagcagccccgcggggcagcggctgctgctgctgctgctcttcgccctgtgccta
ggggcgcgctgcacggagcgcacggcggccaaaagcaggaggcaagcccagcaagttgtc
cagcccccggtgcccggcacgcagagcaaacagggctgttttgacaatggccgacactat
caaataaaccagcaatgggaacgcatttacctgggaaacacactggtctgtacctgctat
gggggatccagaggctttaactgtgaaagcaagcctgaacctgaagaaacttgctttgac
aaatacactggatctacttaccgagtaggggagacttatgagcgccccaaggattccatg
atctgggactgtacttgcattggagctggacgtggaagaatcagctgcactatcgcaaat
cggtgccacgaaggaggtcagtcctacaagattggtgatacgtggcgcagacctcatgag
acaggtggctatatgctagagtgcgtgtgtctaggaaatgggaaaggtgaatggacctgc
aaacctgtagctgagagatgctatgacaacaatgctggaacctcttatgttgttggagag
acttgggagaagccttatcagggctggatgatggtggactgcacctgcttaggtgaaggc
agtggacgtattacctgtacctccagaaatcggtgcaatgatcatgacaccaagacttcc
tacagaattggagatacgtggagtaagaaggataaccgaggaaatctgcttcagtgcatc
tgcactggtaatggcagaggcgagtggaagtgtgaaagacacacatcccttcatactact
agcacaggatctgggtcttctagctttacagatgtacgaactgcactttaccagcctcaa
ccccagccccagccatatggccagtgtataactgataatggagtggtgtactcagttggc
atgcagtggctcaaatcacagggcagccagcagatgctttgtacttgtctgggcaatgga
gtcagctgcaaggagatagctgtgacacaaacctatggtggcaattccaatggagaacca
tgtgttttgccattcacctttgatgggagaaccttctattcttgcacaactgaaggccga
acggatggccagctgtggtgcagcacaacctcagatttcgtgcaggaccggaaatactcc
ttctgcacagaacaaaacggtttggtccagacacgtggcggcaattcaaatggtgctttg
tgctacttccccttcctgtataacaaccgcaactacactgattgtacttctgagggacgg
agagacaacatgaagtggtgtggaaccacccctaactatgatgctgaccagaagtttggc
ttctgccctatggctgcccatgaagaagcctgtacaaccaatgaaggtgtcatgtaccgt
gtgggtgaccagtgggacaaacagcatgatatgggccatatgatgagatgcacttgtatg
ggaaatggccgtggtgaatggacgtgcattccatactcccagctcagagaccagtgtatt
gttgatgacatcacctatgatgttaaccagacatttcacaagcgtcacgaagaagggcat
atgctgaactgcacgtgctttggccagggtcgtgggagatggaagtgtgatcctattgat
cagtgccaggattcagaaacccagaccttctatcaaattggggatgcatgggagaagttc
cttcacaatgttagataccagtgctattgctatggccttggtattggagagtggcattgc
cagcctttgcagacctatccaggttcaactggtccagtccaggtgatcatcacagagagt
cccaatcatcccaactcccatcccatccagtggaatgcacccgaatcttctcacatttct
aagtacattctccgctggaaaccgaaaaactccagagtacattggaaggaagccaccatc
cctggtcacttgaactcctacaccatctcaggcctgaaacctggtgtaatatatgaagga
cagcttgtcagtgtgcaacagtatggactcagagaactcacccgctttgattttactaca
gctgtgatcagcaacacagttgttggagagacaactccacttactcctatggttgctacc
tctgaatcagtcacagaaatcacagccagtagttttgtagtctcctgggtttccgcttct
gacactgtatcaggattccgtgtggaatatgagctcagcgaggagggcgacgaacctcag
tatcttgatctcccaagcacagccacctctgttaacatccctgacttgcttcctggtcgc
aagtacatagttaatgtctaccagatctcagaagaaggagagcaaaacctgatcctgtcc
acgtcacagacaacagcaccagatgcacctccagagcacacggtggaaagtgtggatgac
acctcaattgtcgttagctggagcagaccacaggctcccattacaggttacagaattatc
tatgcaccgtcagtggaagggagcagcactgagctgaacctgcctgatactgctacctct
gtaaccctcagtgatttaatgcctggtgttcagtataatatcagcatttatgcagtggaa
gaaaatcaggagagtactcctgtctttatccagcaggaaaccacaggtgtcccacgtgca
gatgatattccttcacccagagatctacagtttgtggaagtttctgatgtcaaaattacc
atcatgtggaccccacctgagagcactgtgtctggctatcgtgtggaggtgatcccagtt
caccaccctggtgaacatggacagagactgcctattaccaggagttcctttgctgaggtc
atcgaccttctacctggaacaacctatgtctttaagatctttgctgtgagccatgggagg
gagagcaaaccattgactggagagcaaaccaccaaactggatgcccccaccaacctgagg
tttatcaatactactgaatcttcagtgttggtgacctggactccaccacatgctccaatc
tcaggatacagactgactataggtcccacgagaggaggccagccaaggaactataatgtg
ggaccatctgtcattaaatacctgttaaagagtctgcagcctgggactgagtatactgta
taccttgtagcagtgaaaggcaaccagcaaagcaccagagaaactggggtcttcacaact
ttgcagccagtgggctcaatccctctctatcacacagaagtgacagaaacatccattgta
gttacctggacacctgcaccaagaattggtttcaagctgggtgtacgaccaagtcaaggt
ggagaagccccacgggaggtgatttctgaatctggtagcattgtcatatctggcctgact
cctggagtagaatacatctacagcatttcagtcctgatggacggcgaggagagagagaat
ccaatcatcaagagtgtagttacaccattgtccccaccagctacccttcatttggagcct
aacccagacacaggagtcctgactgtatcctgggatagaagtaccactccaggtatttct
gggtacagaattaccactgcccctaccagtggacagcaaggttacaccctggaagaagtg
gtcagtgcagaacagacttactgcacctttgaaaatttgagccctggagtggaatacaac
gtcagtgtgtattcagtcaagggcaaccaggaaagcatccccatctccaaaaccatcaca
caagctgttcctgctccaactgacctgagcttcaccagtgtgggtcccgatgctatgaga
gtggcatggattcctccaacctctattgtcctgagcagtttcctagtgcgttactcccca
gtgaagaatgaggaagatgttgcagagctgactatttcgcccactgacagatcagtgtat
ttacaaaatctcctgcctggcactgaatatctggtgaaggtctatagcatctctgagcac
catgaaagtgtccctttgactggtgtgcagaaaacaggtattgattccccaatgggcatt
gacttttcggatataacagcaaacacttttaccgtccattggattgctcctcgtgctacc
atcactggctacagagttcgacaccagttggagcatggtggtggtagacccaaggaagac
cgtattccaccttctcggaattccatcacactcactaacctggttcccgggtccgagtat
gtggtcagcattattgctttcaatggcagagaagatagcttgcccttggtcggccagcaa
tctacagtgtctgatgttccacaggacttggaagttactcccaccagccccacaagccta
aggatttcctgggatgctccagcagtgacagtgagatactatagaatcacctatggtgaa
acaggtggaagtagccctgtccaggagtttacagtgcctggcaccgtatctgatgctaac
attagtggccttaagcctggagtagactataccatcacagtgtatgcagtaacaggccgt
ggagacagtcctgccagcagcaagccagtcactgttacgtacaaaatagagattaacaca
ccatcccagatgcaagtgactgatgttcaggataacagtatcagtgtcagatgggtgcct
tcatcttctccagtcacaggttatcgagtgacaactgttcccaaggatggccacggaccc
acaaaaactaaaaccgtccctgcagatcaaaccgaagtcactgttgagggcctgcagccc
acagtcgagtatgtgattagtgtctatgctcagaatcaaaatggagaaagcgaacctctg
tctgagacaactgttaccaacattgatcgccctaaaggactgacattcactgaggtggat
gttgattccatcaaaattgcttgggaaagcccacaagggcaagtcaccagttacagggtg
acctactcaagccctgaggatggaatccatgagctattgcctgccccagatggtgaagac
gacactgctgagctgcatggcctcaggcctggttctgagtacactgtcagtatcgttgcc
ttacatgatgacaaggagagccagcccctgactggaacccagtccacagcaattcctcct
ccaacaaacctgaactttgtccaggtgactccaaccagcctgatggtcacctggaatgca
cctaatgttcgtctcaccggctacagagtccgagtgaatcccaaggaaaaaactgggccg
atgaaagaaatcaacctctccccagacagcacatctgctgttgtatcaggattaatggtg
gcaaccaaatatgaagtcagcgtgtatgctctgaaggactctctaactagtcgaccagcc
cagggtgtcatcactacccttgagaatgtcagtcctccccggagggcccgtgtaggtgat
gttactgagacaaccatctcaatcaactggcgcaccaagacagagaccatcactggtttc
caggttgatgccatcccagcaagtggccagaaccccattcgaaggactattaggcctgat
cttagaatgtacaccattactggcttgcaaccaggcactgactacaagatccatctttat
gcactgaatgacaatgcccgcagttccccagttgtgattgatgcttctacaaatgttgat
gctccttcaaacctgcaattcctcacaaccacaagcaactccctgctggttacctggcag
cctcccagggccaagattacgggctatatcatcaagtacaataaacctggagcacagcct
aaagagttgcttccccgaccacgcccgggtaccacagaggccactataattggtctggag
ccaggaacagaatataccatctatatcattgctgtgaagaacaatcaaaagagtgaacca
ttgattggcaggaaaaagacagatgagcttcccacgctggtaacccaaactcaccccaat
cagccagagattctggatgttccttccatcgatgagaggcccccttacttcacaaacaac
aggtatgacaatggaaatggtatccaacttccaggcaccacaggtcagcagccatcaata
ggacaccagggacagcaagttttctttgaggaacatggatttagacggactactccaccc
accacagcaacccccagtagacacaggccaagaccgcaaccaccaaatgtggatgaaaca
gttgaactcgctaggtacccaataccacatgtagttgaaccttcatatcctcactcccgt
gggccaaggcgcaatgacactacaggccaggaagctctttctcggacaacgatctcctgg
aggcccttattggagagcactgaatatctcatctcatgtctcccagtcggcaatgatgaa
gagactttgcagttcagagttcctggaactgcctctagtgctactctgaccggccttact
agaggtgctacctacaacatcatagtggaagcattaaaagatcataggagacaaaaagtt
ctggaggaggttgtcacagtggacaatactgtgtctgaaggattaaaccagccaactgac
gacagttgttatgatacatacactggctccttctattccattggagaggaatgggagcga
ttatctgaaactggctttaaactctggtgccagtgcttaggttttggcagtggtcatttc
agatgtgattcatctaaatggtgccatgataatggtgtgaactacaagattggcgaaaag
tgggaccgtcaaggcgagaatggacagatgatgagctgcacatgtcttggaaatggaaag
ggagaattcaagtgtgaacctcatgaggcaacatgctatgatgacggtaagatgtaccac
gtaggagaacaatggcagaaggaatatcttggtgctatctgttcctgtacttgctatgga
ggacagcagggttggcgctgtgacaactgccgcaggcccaatgtcgacgcagcctcagaa
ggctcttctggccatacctacacacgttttacacagagataccaccagagtacaaatact
aatgtcaactgcccaattgagtgcttcatgcccttagatgtacaggcagacacacaacat
ccacgaggacaataa

DBGET integrated database retrieval system