KEGG   Ailuropoda melanoleuca (giant panda): 100463628Help
Entry
100463628         CDS       T01329                                 

Gene name
HESX1
Definition
(RefSeq) HESX homeobox 1
  KO
K09354  homeobox protein expressed in ES cells 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100463628 (HESX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100463628 (HESX1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, XANF
    100463628 (HESX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 100463628
NCBI-ProteinID: XP_019660785
Ensembl: ENSAMEG00000011722
LinkDB All DBs
Position
Un
AA seq 211 aa AA seqDB search
MGQSQPRGRERPELSFCAAHSRMAPSLPEGARLGESKPSPCSFSIESILGLDQKKDCVPS
MKPHRPWADPCSSSGEDVNLCVHIPSLPNGISFPCTVDRPMPEERFLKYENYFSASERLS
LKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLARKLNLEEDRIQIWFQN
RRAKLKRSHRESQFLMAKKNFNTNLLEEIGN
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggggcagagccagccaagaggcagggagaggccagagctgtcgttctgtgcagcccac
tcgaggatggcccccagtcttccggaaggtgctcggcttggggagagcaaaccctcgccc
tgctccttttcaattgagagcattttaggattggaccagaagaaagactgtgttccttca
atgaaaccccacaggccctgggcagacccctgcagctcctcaggggaagatgttaaccta
tgtgtgcatatcccgagccttcctaatgggatctcattcccttgtactgtggatcgccca
atgccagaagaaagatttttgaaatacgaaaattacttttcagcctcagaaagactgtct
ttgaaaagagagctgagttggtatagaggccggagacccagaactgcttttactcaaaac
cagattgaagtgttggaaaatgtctttagagttaactgctatcctggcattgatatcaga
gaagacttagctcgaaaattgaatctagaggaagacagaatccagatctggtttcaaaat
cggcgtgcaaagctgaaaaggtcccatagagaatcacagttcctaatggcaaaaaaaaat
ttcaacacaaatctcctggaagagataggaaattaa

DBGET integrated database retrieval system