KEGG   Ailuropoda melanoleuca (giant panda): 100463778
Entry
100463778         CDS       T01329                                 

Gene name
TICAM1
Definition
(RefSeq) TIR domain-containing adapter molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04064  NF-kappa B signaling pathway
aml04217  Necroptosis
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml05133  Pertussis
aml05135  Yersinia infection
aml05142  Chagas disease
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100463778 (TICAM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100463778 (TICAM1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100463778 (TICAM1)
   04621 NOD-like receptor signaling pathway
    100463778 (TICAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100463778 (TICAM1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100463778 (TICAM1)
   05133 Pertussis
    100463778 (TICAM1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100463778 (TICAM1)
   05160 Hepatitis C
    100463778 (TICAM1)
   05164 Influenza A
    100463778 (TICAM1)
   05168 Herpes simplex virus 1 infection
    100463778 (TICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100463778 (TICAM1)
   05165 Human papillomavirus infection
    100463778 (TICAM1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100463778 (TICAM1)
SSDB
Motif
Pfam: TRIF-NTD RHIM TIR_2 DUF4335
Other DBs
NCBI-GeneID: 100463778
NCBI-ProteinID: XP_034515905
LinkDB
Position
4
AA seq 720 aa
MACADLSLSSAFDVLGAAGEGKLLHLKHKLKTLRPGCRGADLLHAMVLLKLGQETEARIS
LEALKADAVARLVARQWAGMDSAEVPEEPPDLSWAVARVYHLLAEEKLCPATMRDMAYQA
ALHTFSSRDDHRLAELQGEAQDRCGWGIIGDTGSFQPLHSDLGCLPPSSVSPSGTRSLPQ
PIEHLSGWSRGRSLRSTGSPASLASHLEISQSPTMPFLSHHRSCHGPSKLCDEPQASLVP
EPAPPGCQEPQEVSWPPSIETVSPPSVETANPPQGETVRPSSGETASPPLGETVSPSSGK
TASPPSGETASPPLEETASPSPGETTSSQMPPNSAAPRLTELVPDASPAGQPDPPRALEI
STHYPVECTDALAAPESLSLPSRNTWPDKGQSPFPLPEEDTASQVASASPPPPAPLKTSP
PHPSPSTLPSTGLASSSLCPPSPELESEQKFYNFVILHVAADEHIALRVRERLEALGVPD
GATFCEDFQVPGRGELHCLQDAIDHSAFTILLLTPNFDCRLGLHQASQSLMNSLTRPGRQ
DCVIPFLPLESSQAPLSPYTTSLLTGLVWLDEHSQIFARRVANTFKAQRLRARKANWKKE
QDVRALQEQRRHLEGERQQVAALNAAYSAYFQSCLSWQAQMETLRMAFDSHMPFGTQMPP
GSPSPPFPSWPGHQPPPAPPWLAGSPAPGSQSIARDRESDRGIRPVMEECRGLQRPKGDH
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggcctgcgcggacctgtcgctctccagcgcctttgacgttctcggcgctgcaggggag
ggcaagctcttgcaccttaagcacaagctgaagaccctgcgcccgggctgccggggggcg
gacctcctgcacgccatggtgctcctgaagctgggccaggagaccgaggccaggatctcc
ctggaagcactgaaggcggacgcggtggcccggctcgtggcgcgccagtgggccggcatg
gacagcgccgaggtcccagaggagcccccagacttgtcctgggcagttgcccgggtgtac
cacctgctcgccgaggagaagctgtgcccggccactatgcgggacatggcctaccaggcc
gccctccatacgttcagctccagggatgaccaccggctcgccgagctccagggagaggcc
caggaccggtgtgggtggggcatcatcggggacacagggagcttccagccccttcactct
gatctgggctgcctgccaccatcctcagtgtcaccctcaggcacccgcagccttccacag
cccatagagcacctttcaggctggagcagagggcgttccctgagatccactggcagcccc
gcctccctggccagccatctggaaatcagccagtcccccaccatgccctttctcagccat
caccgcagctgccatgggcccagcaagctgtgtgacgagccccaggccagcctggtgccc
gagcctgcccccccgggctgccaggagcctcaggaggtgagctggccaccgtcaattgag
actgtcagccccccatcggtggagactgccaaccccccacaaggggagactgtcagaccc
tcatcaggagagacagccagccccccgctgggggagactgtcagcccctcatcaggaaag
acagccagccccccatcgggggagactgccagccccccactggaggagactgctagcccc
tcacctggggagactaccagctcccagatgccaccaaacagtgcagcccctaggcttact
gagctggtcccagatgcaagccctgctggccagcccgacccccccagagctctggaaatc
agcacccactacccggtggagtgcaccgacgcgttggcagcccccgaatctctttccttg
ccctccagaaacacttggcctgacaagggccagagcccattcccacttcctgaagaagat
accgcttctcaggtggccagcgccagcccccctccacccgcacccctgaagacgtcccct
ccccacccttctccatccacccttccttccactggcctggcctcctccagcctgtgcccc
ccttctcccgagctggagtccgagcagaaattctataactttgtgatcctgcacgttgcc
gcggatgaacacattgccctgcgggtccgggagaggctcgaggccctgggggtccccgat
ggggccaccttctgtgaagatttccaggtgcccgggcggggcgagctgcactgcctgcaa
gacgccatcgaccattcggccttcaccatcctgctgctcacccccaacttcgactgccgc
ctgggcctgcaccaggccagccagtcgctgatgaacagcctcacgcggcccgggcggcaa
gactgcgtgatccccttcctgcccctggagagctcccaggccccgctcagcccctacacg
accagcctgctcaccggcctggtgtggctggacgagcactcccagatcttcgccaggagg
gtggccaacaccttcaaggcgcagaggctacgagcccgcaaggccaactggaagaaggaa
caggacgtccgggccctgcaagagcagcgccggcacctggagggcgagcggcagcaggtg
gcagcgctgaacgccgcctactcggcctacttccagagctgcttgtcctggcaggcgcag
atggagaccctccggatggccttcgacagccacatgccgtttgggactcagatgcccccc
gggagcccctccccgccctttccctcctggccaggccaccagccgccccctgcgcctccg
tggctggccggctcgcccgcacccggctcacagtccattgccagagacagagaaagtgac
cgggggatcaggcctgtgatggaagaatgtaggggattgcagaggcccaaaggggaccac
tga

DBGET integrated database retrieval system