KEGG   Ailuropoda melanoleuca (giant panda): 100463878
Entry
100463878         CDS       T01329                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04390  Hippo signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05200  Pathways in cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100463878 (FGF1)
   04014 Ras signaling pathway
    100463878 (FGF1)
   04015 Rap1 signaling pathway
    100463878 (FGF1)
   04390 Hippo signaling pathway
    100463878 (FGF1)
   04151 PI3K-Akt signaling pathway
    100463878 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100463878 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100463878 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100463878 (FGF1)
   05218 Melanoma
    100463878 (FGF1)
   05224 Breast cancer
    100463878 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100463878 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100463878 (FGF1)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100463878 (FGF1)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100463878 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100463878
NCBI-ProteinID: XP_019650803
Ensembl: ENSAMEG00000010197
UniProt: D2GUK9
LinkDB
Position
3
AA seq 155 aa
MAEGEITTFTALTEKFNLPAGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggagatcacaaccttcaccgccctgacggagaagtttaatctgcctgcg
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggacgggacgagggacaggagcgaccagcacattcaactgcag
ctcagcgcggaaagcgtaggggaggtgtacataaagagcaccgagaccggccagtacttg
gccatggacaccgatgggcttctgtacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcggagaag
aattggtttgttggtctcaagaagaatggaagctgcaaacgtggtcctcggactcactat
ggccagaaagcaattctgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system