KEGG   Ailuropoda melanoleuca (giant panda): 100464621
Entry
100464621         CDS       T01329                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6 isoform X1
  KO
K02376  frizzled 6
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100464621 (FZD6)
   04390 Hippo signaling pathway
    100464621 (FZD6)
   04150 mTOR signaling pathway
    100464621 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100464621 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100464621 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100464621 (FZD6)
   05205 Proteoglycans in cancer
    100464621 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100464621 (FZD6)
   05226 Gastric cancer
    100464621 (FZD6)
   05217 Basal cell carcinoma
    100464621 (FZD6)
   05224 Breast cancer
    100464621 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100464621 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    100464621 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100464621 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100464621 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aml04030]
    100464621 (FZD6)
G protein-coupled receptors [BR:aml04030]
 Frizzled / Smoothened family
  100464621 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec RseC_MucC Integrin_alpha
Other DBs
NCBI-GeneID: 100464621
NCBI-ProteinID: XP_002930846
Ensembl: ENSAMEG00000016355
UniProt: D2I6J3
LinkDB
Position
9
AA seq 712 aa
MEMLTFLWTCVFLPLIRGHSLFTCEPITVPRCMKMAYNMTFFPNLMRHYDQSTAAVKMEP
FLPLANLECSPNIETFLCKAFVPACTEQINVVPPCRNFCEKVYSDCKKLIDTFGMRWPEE
LECDRLQYCDETVPVTFDPHTQFLGPQKKAEEVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGDRTACNKADEKLELGDTVVLGSQNKACTVLFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKTETRPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGAATHHGASSVAITNHDYLGQETLTEIPTSPETSVREV
RADGASTPRSREQDCGEPASPAASSSKLCGEQADRRGRAGNGNDKISVSESMRSEGRLTP
KSDVTEMGPAQSSSLQAPGSLEPGSPRGSTSLLIHSASGGSKEQGPGAPSDT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggaaatgttgacatttttgtggacgtgtgtttttctacccctcataagagggcacagt
cttttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatttgatgaggcattatgaccagagtacagctgctgtgaaaatggagcct
tttcttcctcttgcaaatttggaatgttcaccaaacatcgaaactttcctttgcaaagct
tttgtaccagcctgcacagaacagattaatgtggttccaccttgtcgtaacttttgtgag
aaagtatattctgattgcaaaaaattaattgacacctttggtatgcgatggcctgaggaa
cttgaatgtgacaggttgcaatactgtgatgagaccgttcctgtaacttttgatccacac
acacagtttcttggtcctcagaagaaagcagaggaagttcaaagagacattgggttttgg
tgtccaaggcatcttaagacttctgggggacaaggctataagtttctgggaattgaccag
tgcgcacctccatgccctaacatgtattttaaaagtgatgagctagagtttgcaaaaagt
tttatcgggatagtttcaatattttgtctctgtgcaactctgttcacattccttactttc
ttaattgatgttaaaagattcagatacccagagagaccgattatatattactccgtctgc
tacagcattgtgtccctgatgtactttattggattcttgttaggtgatcgcacagcctgc
aacaaggcagatgagaagctagaactcggggacacagtagttctgggctctcagaataag
gcctgcactgttctgtttatgtttttgtattttttcacaatggccggcacggtgtggtgg
gtgatccttaccattacgtggttcctagcggcaggaagaaaatggagttgtgaagccatt
gaacaaaaagcggtgtggtttcatgccgttgcgtggggaataccaggttttctgaccgtg
atgcttcttgctatgaacaaagttgaaggagacaacattagtggtgtttgcttcgtcggc
ctttatgacctggatgcttctcgctactttgtgctcctgccactgtgcctttgtgtgttt
gttgggctgtctcttcttttagctggcattatttccttaaatcacgttcgacaagttata
caacatgatggccggaaccaagagaaactaaagaaatttatgattcggattggagtcttt
agtggcctgtatcttgtgccactagtgacacttctgggatgttacgtctatgagcaagtg
aacaggatcacctgggagataacctgggtctccgaccactgtcgtcagtaccacatccca
tgtccttatcaggcaaaaacagaaactcgaccagaattggctttatttatgataaaatat
ctgatgacgttaattgttggcatctctgccgtcttctgggttggaagcaaaaagacctgc
acggaatgggctgggttttttaaacgaaatcgtaagagagatccaatcagtgaaagtcga
agagttctacaggagtcatgtgagttcttcttaaagcataattctaaagtcaaacacaaa
aagaagcactacaaaccgagttcgcataagctgaaggtcatttccaaatccatggggacc
agcacaggcgctgccacccatcatggcgcctcctcggtggcgatcaccaaccacgattac
ttaggacaagagactttgacagaaataccaacctccccagagacatcagtgagagaggtg
agagcagatggagcgagcacccccagatccagagaacaggactgtggggagccggcctcc
ccagcagcatccagctccaaactctgtggggaacaggccgaccggagaggccgggcaggc
aatgggaatgataagatcagcgtatccgaaagtatgcggagtgaaggaaggctaactcca
aaaagtgacgtcaccgaaatgggcccagcacagagcagcagcctgcaggcccctggttct
ttggagccaggcagcccgagaggctccacgtcactgctcattcactcggcttcgggaggg
agcaaagagcaaggccccggcgctccctccgatacgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100467779
Entry
100467779         CDS       T01329                                 

Gene name
FZD8
Definition
(RefSeq) frizzled-8
  KO
K02375  frizzled 5/8
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100467779 (FZD8)
   04390 Hippo signaling pathway
    100467779 (FZD8)
   04150 mTOR signaling pathway
    100467779 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100467779 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100467779 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467779 (FZD8)
   05205 Proteoglycans in cancer
    100467779 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100467779 (FZD8)
   05226 Gastric cancer
    100467779 (FZD8)
   05217 Basal cell carcinoma
    100467779 (FZD8)
   05224 Breast cancer
    100467779 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100467779 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    100467779 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100467779 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100467779 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aml04030]
    100467779 (FZD8)
G protein-coupled receptors [BR:aml04030]
 Frizzled / Smoothened family
  100467779 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100467779
NCBI-ProteinID: XP_034499548
LinkDB
Position
15
AA seq 334 aa
RAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLT
WFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDN
LRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLY
TVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITS
GVWVWSGKTLESWRALCTRCCWASKGATGGGGAGAAAAGXXXXXXXXXXXXXXXXXAPGG
GAGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
NT seq 1005 nt   +upstreamnt  +downstreamnt
cgcgcggcgggcgcgggagcaggtggccccggcgggcggggcgagtacgaggagctgggc
gctgtggagcagcacgtgcgctacgagaccacgggcccggcgctgtgcaccgtggtcttc
ttgctcgtctacttcttcggcatggccagctccatctggtgggtgatcctgtcgctcacg
tggttcctggcggcgggcatgaaatggggcaacgaggccatcgccggctactcgcagtac
ttccacctggccgcgtggctcgtgcccagcgtcaagtctatcgccgtgctggcgctcagc
tccgtggacggcgacccggtggctggcatctgctacgtgggcaaccagagcctcgataac
ctgcgcggcttcgtgctggcgccgctcgtcatctacctcttcattggcaccatgttccta
ctggccggcttcgtgtcgctcttccgcatccgctcggttatcaaacagcagggcggcccc
accaagacgcacaaactggagaagctcatgatccgcctgggtctcttcaccgtgctctac
accgtgcccgccgccgtcgtggtcgcctgcctcttctatgagcagcacaaccgcccgcgc
tgggaggccacgcacaactgcccgtgcctacgggacctgcagccagaccaggcgcgccgg
ccggactacgccgtcttcatgctcaagtacttcatgtgcctcgtggtgggcatcacctcg
ggcgtgtgggtctggtccggcaagacgctcgagtcgtggcgtgccctgtgcacccgttgc
tgctgggccagcaagggcgccacggggggcgggggcgcgggcgccgcggccgcgggnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngggccccgggcggt
ggggcgggatccctctacagcgacgtcagtaccggcctgacgtggcgatctggcacggcc
agctccgtgtcttatccaaagcagatgccattgtcccaggtctga

KEGG   Ailuropoda melanoleuca (giant panda): 100468831
Entry
100468831         CDS       T01329                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3 isoform X1
  KO
K02329  frizzled 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100468831 (FZD3)
   04390 Hippo signaling pathway
    100468831 (FZD3)
   04150 mTOR signaling pathway
    100468831 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100468831 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100468831 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    100468831 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100468831 (FZD3)
   05206 MicroRNAs in cancer
    100468831 (FZD3)
   05205 Proteoglycans in cancer
    100468831 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100468831 (FZD3)
   05226 Gastric cancer
    100468831 (FZD3)
   05217 Basal cell carcinoma
    100468831 (FZD3)
   05224 Breast cancer
    100468831 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100468831 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    100468831 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100468831 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100468831 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aml04030]
    100468831 (FZD3)
G protein-coupled receptors [BR:aml04030]
 Frizzled / Smoothened family
  100468831 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100468831
NCBI-ProteinID: XP_002918914
Ensembl: ENSAMEG00000015975
UniProt: D2HAJ0
LinkDB
Position
5
AA seq 666 aa
MAMSWIVFYFWPLTVFVGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSELMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGVPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEVVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggattgtcttctacttttggcccttgactgtgtttgtgggacatata
ggtgggcacagtttgttttcttgtgaacccattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcactatgaccaacagacagcagcttta
gcaatggagccattccacccaatggtgaatctggattgttctcgggattttcggccattt
ctttgtgcactctatgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcagcgggcttacagtgagtgttcggagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccatatcctcgactt
gtggatctgaatttagctggtgatcctactgaaggagttccagtggcagtgcagagggac
tatggtttttggtgtcctcgagagttgaaaattgatcctgatcttggttattctttttta
cacgtgcgtgattgttcacctccttgtccaaatatgtactttaggagagaagaactttca
tttgctcgatacttcataggattgatttcaatcatttgcctctctgccacgttgtttact
tttttaacttttttgattgatgtcacaagattccgttatcccgaaagacctattatattt
tatgcagtctgctacatgatggtatcattaattttcttcattgggtttttgcttgaggac
cgcgtagcctgcaatgcatctagccctgcacagtataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatggtactctatttttttactatggctggc
agtgtttggtgggtaattcttaccatcacatggttcttggcagctgtgccaaagtggggt
agtgaagctattgagaagaaagccttgctatttcacgccagtgcatggggcatccccgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatatcagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagttggagtttctctccttttagctggcattatatccctaaacagagtt
cgaattgaaattccattagaaaaggagaaccaagataagttggtgaagtttatgatccgg
attggtgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcctaccgtggcatctgggaaacaacatggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacctgattctcttt
ctgatgaaatacctgatggctctcatagttggtattccctccattttttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcacggtcgtaggaaaaaagaggtagtg
aatgagagccgacaggtactacaggaacctgattttgctcagtctcttctgagggatcca
aatactcctattataagaaaatcaagaggaacttccactcaaggaacatccacacatgca
tcttcaactcagcttgctatggtggatgatcagagaagcaaagcaggtagtgtccacagc
aaagtaagcagctaccacggcagtctccacagatcccgtgatggcaggtatactccctgc
agttacagaggaatggaagagagactacctcacggcagcatgtcacgactgacggatcac
tccaggcacagcagttctcatcggctcaatgaacagtcacgacacagcagcatcagagac
ctcagtaataatcctatgactcacatcacacatggtaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

KEGG   Ailuropoda melanoleuca (giant panda): 100469196
Entry
100469196         CDS       T01329                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100469196 (FZD1)
   04390 Hippo signaling pathway
    100469196 (FZD1)
   04150 mTOR signaling pathway
    100469196 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100469196 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100469196 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100469196 (FZD1)
   05205 Proteoglycans in cancer
    100469196 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100469196 (FZD1)
   05226 Gastric cancer
    100469196 (FZD1)
   05217 Basal cell carcinoma
    100469196 (FZD1)
   05224 Breast cancer
    100469196 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100469196 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    100469196 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100469196 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100469196 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aml04030]
    100469196 (FZD1)
G protein-coupled receptors [BR:aml04030]
 Frizzled / Smoothened family
  100469196 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 100469196
NCBI-ProteinID: XP_002927799
Ensembl: ENSAMEG00000019295
UniProt: D2HY60
LinkDB
Position
1
AA seq 651 aa
MAEEEAPKKSRAAGGRASWELYARALPAGRVAEGSGDAGSRRQRRPPADSGRLARRLLLL
LWLLEAPLLLGVRGQAVGQGPGQGPGPGQQPPPPPPQQQQSGQQYNGERGISIPDHGYCQ
PISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVC
TVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGT
PTPSLLPEFWTSNPQHGGGGHRGGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDC
GAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPII
FLSGCYTAVAVAYIAGFLLEDRVVCNDKFSEDGARTVAQGTKKEGCTILFMMLYFFSMAS
SIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGV
CFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVR
IGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPM
SPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNTKQGETTV
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggctgaagaggaggcgcctaagaagtcccgggccgccggcggccgcgcgagctgggaa
ctttatgccagggcgctcccggctggacgggtggcggaggggagcggggacgcgggcagc
cgtcgccaacgccgccccccagctgactctggacgcttggcgcgccggctcctgctactg
ctttggctgctggaggctccactgctgctgggggtccgagggcaggcggtgggccagggg
ccgggccaggggcccgggccggggcagcagcccccgccgccgccgcctcagcagcagcag
agcggacaacagtacaacggcgagaggggcatctccatcccggaccacggctactgccag
cccatctccatcccgttgtgcacggacattgcgtacaaccagaccatcatgcccaacctt
ttgggccacacgaaccaagaggatgcgggcctcgaggtgcaccagttctaccccttggtg
aaggtgcagtgctcggcggaactcaaattcttcctgtgctccatgtacgcgcccgtgtgc
accgtgctggagcaggctctgccgccctgccgctccctgtgtgagcgcgcgcgccagggc
tgcgaggcgctcatgaacaagttcgggttccagtggcccgacacgctcaagtgcgagaag
ttcccggtgcacggcgccggcgagctgtgcgtgggccagaacacgtcggacaagggcacc
ccaacgccctcgttgctgccggagttctggaccagcaaccctcagcacggcggcgggggg
caccgtggcggcggctttccggggggcgccggcgcgtcggagcgaggcaagttctcgtgc
ccgcgcgccctcaaggtgccctcctaccttaactaccacttcctgggggagaaagactgc
ggtgcgccctgtgagccgaccaaggtgtacgggctcatgtactttggaccggaagagctg
cgcttctcgcgcacctggatcggcatctggtcagtgctgtgctgcgcctccacgctcttc
acggtgctcacgtacctggtggacatgcggcgcttcagctacccggagcggcccatcatc
ttcctgtctggctgctacacggcagtggccgtggcctacatcgccggcttcctgctggag
gaccgagtggtgtgtaatgacaagttttccgaggatggggcgcgcacagtggcgcagggc
acgaagaaggagggctgcaccatcctcttcatgatgctctacttctttagcatggccagc
tccatctggtgggtgattctgtctctcacctggttcctggcagcgggcatgaagtggggt
cacgaagccatcgaggctaactcgcaatattttcacctggccgcctgggccgtgccggcc
atcaagaccatcaccatcctggcgctgggccaggtggatggcgacgtgctgagcggggta
tgcttcgtggggctcaacaatgtggacgcgctgcgcggcttcgtgctggcgccactcttc
gtgtacctgttcatcggcacgtctttcctgctggccggctttgtgtcgctcttccgcatt
cgcaccatcatgaagcacgacggcaccaagacggagaagctggagaagctcatggtgcgc
atcggcgttttcagcgtgctttacacggtgccggccactatcgtcatcgcctgctacttc
tatgagcaggccttccgggaccagtgggagcgcagctgggtggcccagagctgcaaaagc
tatgccatcccctgcccccacctccaggcgggtggaggcgccccgccgcacccgcccatg
agcccagactttacagtctttatgatcaagtaccttatgacgctgatcgtgggcatcacg
tcaggtttctggatctggtccggcaagaccctcaactcctggaggaagttctatactagg
ctcaccaacaccaaacagggagagaccaccgtctga

KEGG   Ailuropoda melanoleuca (giant panda): 100469249
Entry
100469249         CDS       T01329                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100469249 (FZD2)
   04390 Hippo signaling pathway
    100469249 (FZD2)
   04150 mTOR signaling pathway
    100469249 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100469249 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100469249 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100469249 (FZD2)
   05205 Proteoglycans in cancer
    100469249 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100469249 (FZD2)
   05226 Gastric cancer
    100469249 (FZD2)
   05217 Basal cell carcinoma
    100469249 (FZD2)
   05224 Breast cancer
    100469249 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100469249 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    100469249 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100469249 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100469249 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aml04030]
    100469249 (FZD2)
G protein-coupled receptors [BR:aml04030]
 Frizzled / Smoothened family
  100469249 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100469249
NCBI-ProteinID: XP_034497254
LinkDB
Position
13
AA seq 565 aa
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGTPALLTTAPPPGLQPGAGGTP
GGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgctgccgctgctgctgctgcccgccgcc
gggccggcccagttccacggggagaagggcatctccatcccagaccacggcttctgccag
cccatctccatcccgctgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccacacgaaccaggaggacgcggggctggaggtgcatcagttctacccgttggtg
aaggtgcagtgctcccccgaactgcgcttcttcttgtgctccatgtatgcacccgtgtgc
accgtgctggagcaggccatcccgccgtgccgctccatctgcgagcgcgcacgccagggc
tgcgaggcgctcatgaacaagttcggcttccagtggcccgagcgtctgcgctgcgagcac
tttccgcgccacggcgccgagcagatctgcgtgggccagaaccactctgaggacggcacg
ccggcgctgctcaccaccgcgcctccgccgggcctgcagccgggggccgggggcaccccg
ggcggcccgggcggcggcggctctcctccgcgctacgccacgctggagcacccgttccac
tgcccgcgcgtcctcaaggtgccgtcctatctcagctacaagttcctgggcgagcgcgac
tgcgcggcgccctgcgagcccgcgcggcccgacggctccatgttcttctcgcaggaggag
acgcgcttcgcgcgcctctggatcctcacctggtcggtgctgtgctgcgcctccaccttc
ttcactgtcactacgtacctggtggacatgcagcgcttccgctacccggagcgccccatc
atctttctgtccggctgctacactatggtctcggtggcctacatcgcgggcttcgtgctc
caggagcgcgtcgtgtgcaacgagcgcttttccgaggacggctaccgcacggtagtgcag
ggcaccaagaaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggcc
agctccatctggtgggtcatcctgtcgctcacttggttcctggcggccggcatgaagtgg
ggccacgaggccatcgaggccaactcgcagtacttccacctggccgcgtgggccgtgccg
gcggtcaagaccatcacgatcctcgccatgggccagattgacggcgacctgctgagcggc
gtgtgcttcgtgggcctcaacagcctggacccgctgcgcggcttcgtgctggcgccgctc
ttcgtgtacctgttcatcggcacgtccttcctcctggccggtttcgtgtccctcttccgc
atccgcaccatcatgaagcacgacggcaccaagacggagaagctggagcggctgatggtg
cgcatcggcgtcttctcggtgctctacaccgtgcctgccaccatcgtcatcgcctgctac
ttctacgagcaggcctttcgagagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgccccgcgcactacacgccgcgcatgtcgcccgacttcaccgtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tccggcaagacattgcactcgtggagaaagttctacacccgtctcaccaacagccggcac
ggcgagaccaccgtgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100469765
Entry
100469765         CDS       T01329                                 

Gene name
FZD9
Definition
(RefSeq) LOW QUALITY PROTEIN: frizzled-9
  KO
K02842  frizzled 9/10
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100469765 (FZD9)
   04390 Hippo signaling pathway
    100469765 (FZD9)
   04150 mTOR signaling pathway
    100469765 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100469765 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100469765 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100469765 (FZD9)
   05205 Proteoglycans in cancer
    100469765 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100469765 (FZD9)
   05226 Gastric cancer
    100469765 (FZD9)
   05217 Basal cell carcinoma
    100469765 (FZD9)
   05224 Breast cancer
    100469765 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100469765 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    100469765 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100469765 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100469765 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aml04030]
    100469765 (FZD9)
   04090 CD molecules [BR:aml04090]
    100469765 (FZD9)
G protein-coupled receptors [BR:aml04030]
 Frizzled / Smoothened family
  100469765 (FZD9)
CD molecules [BR:aml04090]
 Proteins
  100469765 (FZD9)
SSDB
Motif
Pfam: Frizzled Dicty_CAR Fz
Other DBs
NCBI-GeneID: 100469765
NCBI-ProteinID: XP_011228465
LinkDB
Position
10
AA seq 475 aa
QARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATGPAEPHKGLGMLPVAP
XPARPPGDPASGPGGGGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMA
VWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQ
EAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGS
YFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASMDAAALTGFVLVPLSCYLVLGTSF
LLTGFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFW
RLRATEQPCSAATMPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQT
WQSLCHRKMAAGRARAKACRAPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1428 nt   +upstreamnt  +downstreamnt
caggcgcgcctccgctgcgcgcccataatggagcagttcaacttcggctggccggactcg
ctggactgcgcccggctgcccacgcgcaacgacccgcacgcgctctgcatggaggctccc
gagaacgccacgggccccgccgagccccacaagggcctgggcatgctgcccgtggcgccc
nngcccgcgcggccccccggcgaccccgcctcgggcccgggcggcggtggcggcacctgc
gataacccggagaagttccagtacgtggagaagagccgctcgtgcgcgccgcgctgcgga
cccggcgtcgaggtgttctggtcgcggcgcgacaaggacttcgcgctcgtctggatggcc
gtgtggtcggcgctgtgcttcttctccacggccttcaccgtgctcaccttcctgctggag
ccgcaccgcttccagtaccccgagcgccccatcatcttcctgtccatgtgctacaacgtc
tactcactggccttcctcatccgcgccgtggcgggcgcccagagcgtggcctgcgaccag
gaggcgggcgcgctctacgtgatccaggaggggctggagaacacgggctgcaccctcgtc
ttcctgctgctctactacttcggcatggccagctctctgtggtgggtggtgctgaccctc
acctggttcctggcggccggcaagaagtggggccacgaggccatcgaggcccatggcagc
tacttccacatggcggcctggggcctgccggccctcaagaccatcgtcatcctgacactg
cgcaaggtggctggagacgagctcacagggctctgctacgtggccagcatggacgcggct
gcgctgacgggcttcgtgctggtgcccctctcctgctacctggtgctgggcaccagcttc
ctcctgaccggcttcgtggccctcttccacatccgcaagatcatgaagacgggcggcacc
aacacagagaagctggagaagctcatggtcaagattggggtcttctccatcctctacacg
gtgcctgccacctgcgtcatcgtgtgctacgtctatgaacgcctcaacatggacttctgg
cgtcttcgggccacagagcagccctgctcggcagccaccatgcccgggggccgaagggac
tgctcgctaccagggggctcggtgcccaccgtggctgtctttatgctcaaaatcttcatg
tcgctggtggtgggcatcaccagcggagtctgggtgtggagctccaagactttccagacc
tggcagagcctgtgccaccgcaagatggcagctggtcgggcccgggcaaaggcctgccgg
gctcccgggggctacggccgtggcacgcactgccactacaaggctcccaccgtggtcttg
cacatgactaagacggacccttctctggagaaccccacgcacctctag

KEGG   Ailuropoda melanoleuca (giant panda): 100470379
Entry
100470379         CDS       T01329                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100470379 (FZD4)
   04390 Hippo signaling pathway
    100470379 (FZD4)
   04150 mTOR signaling pathway
    100470379 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100470379 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100470379 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100470379 (FZD4)
   05205 Proteoglycans in cancer
    100470379 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100470379 (FZD4)
   05226 Gastric cancer
    100470379 (FZD4)
   05217 Basal cell carcinoma
    100470379 (FZD4)
   05224 Breast cancer
    100470379 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100470379 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    100470379 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100470379 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100470379 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aml04030]
    100470379 (FZD4)
   04090 CD molecules [BR:aml04090]
    100470379 (FZD4)
G protein-coupled receptors [BR:aml04030]
 Frizzled / Smoothened family
  100470379 (FZD4)
CD molecules [BR:aml04090]
 Proteins
  100470379 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 100470379
NCBI-ProteinID: XP_002925226
Ensembl: ENSAMEG00000006294
UniProt: D2HRQ0
LinkDB
Position
8
AA seq 537 aa
MAWRGAVPSLLGAPGGVDLSLRLLLLLLLLLEPARGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcctggcggggcgcagtgccgagcctcctaggggcgcccgggggcgtcgatctcagt
ctgcggctgctgctgctgttgctgctgctcctggagccagcgcggggcttcggggacgag
gaggagcggcgctgcgaccccatccgcatctccatgtgccagaacctgggctacaacgtg
accaagatgcccaacctggtggggcacgagctgcagacagacgccgagctgcagctgaca
actttcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgttcg
gtttatgtgccaatgtgcacagagaagatcaacatccccatcggcccatgcggcggcatg
tgtctttcagtcaagaggcgctgtgaacccgtcctgaaggaatttgggtttgcctggcca
gagagcctgaactgcagcaaattcccaccccagaatgaccacaaccacatgtgcatggaa
gggccaggtgatgaggaggtgccgctacctcacaaaacccccatccagcctggggaagag
tgccattccgtaggcaccaactcggatcagtacatctgggtgaagaggagcctgaactgt
gttcttaagtgtggctatgatgctggcttatacagccgctcagccaaggagttcacggac
atctggatggccgtgtgggccagcctgtgcttcatctccactgccttcacggtgctcacc
ttcctgatcgattcctccaggttttcctaccctgagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgtcaggctgaccgtaggccgggaaaggata
tcctgcgattttgaagaggcagcagaacctgttctcatccaagaaggacttaagaacaca
ggatgtgcaatcattttcttgctgatgtacttttttggaatggcaagttccatctggtgg
gttattctgacactcacttggtttttggcagcgggacttaaatggggtcatgaggccatt
gagatgcacagctcttatttccacatcgccgcctgggccatccctgcagtgaaaaccatt
gtgatcttgattatgagactggtggatgcggatgagctgaccggcctctgctatgttggg
aaccaaaacctcgatgccctcacgggctttgtggtagctcccctcttcacttacttggtg
atcggaactctgttcatcgccgctggtttagtggccttgttcaaaattcggtccaatctg
caaaaggatgggacaaagacagacaagttggaaaggctgatggtcaagatcggggtcttc
tcagtcctgtacacagtgcctgccacctgtgtgattgcctgttatttctatgaaatctcc
aactgggcactcttccggtattctgcagatgactccaatatggcagtggaaatgttgaaa
atttttatgtctttgctggtgggcatcacttcaggcatgtggatttggtctgccaaaact
ctgcacacctggcaaaagtgttctaacagattggtgaattctgggaaggtaaagagagaa
aagcgagggaacggttgggtgaagcctgggaaaggcaatgaaactgtggtataa

KEGG   Ailuropoda melanoleuca (giant panda): 100478649
Entry
100478649         CDS       T01329                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100478649 (FZD5)
   04390 Hippo signaling pathway
    100478649 (FZD5)
   04150 mTOR signaling pathway
    100478649 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100478649 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100478649 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100478649 (FZD5)
   05205 Proteoglycans in cancer
    100478649 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100478649 (FZD5)
   05226 Gastric cancer
    100478649 (FZD5)
   05217 Basal cell carcinoma
    100478649 (FZD5)
   05224 Breast cancer
    100478649 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100478649 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    100478649 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100478649 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100478649 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aml04030]
    100478649 (FZD5)
G protein-coupled receptors [BR:aml04030]
 Frizzled / Smoothened family
  100478649 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100478649
NCBI-ProteinID: XP_019653975
LinkDB
Position
2
AA seq 590 aa
MARPDPSAPPSLLLLLLAQLAGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPAGAPASGG
ECAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFSSRCCCR
PRRGHKSGGATAAGDYEASAALTGRTGPSGPPTAAAAAAAYHKQVSLSHV
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccgtccgcaccgccttcgctgctgctgctgctcctggcgcagctg
gcgggccgggcggcggctgcctccaaggccccagtgtgccaggaaatcacagtgcccatg
tgccgcggcataggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggctggcctggaggtacaccaattctggccgctggtggagatccactgctcgccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgcctgccggactaccacaag
ccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cggcagtacggctttgcctggccggagcgcatgagctgcgaccgcctcccggtcctgggc
cgcgacgccgaggtcctgtgcatggattacaaccgcagcgaggccaccacggcgcccccc
aggcccttcccggccaaacccaccctcccaggcccagcgggggccccggcctccgggggc
gagtgcgccgccgggggcccgtcagtgtgcaagtgccgggagcccttcgtgcccatcctg
aaggagtcgcacccgctctacaacaaggtgcgcacgggccaggtgcccaactgcgcggtg
ccctgctaccagccctccttcagccccgacgagcgcacgttcgccaccttctggattggc
ctgtggtctgtgctgtgcttcatctccacctccaccacggtggccaccttccttatagac
atggaacgcttccgctaccctgagcgtcccatcatcttcctgtctgcctgctacttgtgc
gtgtcgctgggcttcctggtgcgcctggtggtgggccatgccagtgtcgcctgcagccgc
gagcatagccacattcactacgagacgacaggccctgcgctgtgcactgtcgtcttcctg
ctggtctacttctttggtatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcagctggcatgaagtggggcaacgaggccatcgcgggctatgcacagtacttc
cacctggccgcgtggctcatccccagcgtcaagtccatcacagcgctggcactgagctcc
gtggacggggaccccgtggccggcatctgctacgtgggcaaccagaacctgaactcgctc
cgcggcttcgtgctgggcccgctggtgctctacctgctggtgggtaccctcttcctcctg
gcgggtttcgtgtcgctcttccgcatccgtagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctgatgatccgcatcggtatcttcacgctgctctacacggtgccg
gccagcatcgtggtggcctgctacctgtacgagcagcactatcgcgagagctgggaggct
gcgctcacctgcgcgtgcccaggcccagacgccggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgcctcgtggtgggcatcacgtcgggcgtctgg
atttggtccggcaagactgtggagtcgtggcggcgcttcagtagccgctgctgctgccgc
ccgcggcggggccacaagagcggcggcgccacggccgccggggactatgaggcgagcgcg
gcgctcacgggcaggaccgggccgtcgggcccccccacagccgccgccgcggccgccgcc
taccacaagcaggtgtccctgtcccacgtgtag

KEGG   Ailuropoda melanoleuca (giant panda): 100479765
Entry
100479765         CDS       T01329                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100479765 (FZD10)
   04390 Hippo signaling pathway
    100479765 (FZD10)
   04150 mTOR signaling pathway
    100479765 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100479765 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100479765 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479765 (FZD10)
   05205 Proteoglycans in cancer
    100479765 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100479765 (FZD10)
   05226 Gastric cancer
    100479765 (FZD10)
   05217 Basal cell carcinoma
    100479765 (FZD10)
   05224 Breast cancer
    100479765 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100479765 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    100479765 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100479765 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100479765 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aml04030]
    100479765 (FZD10)
   04090 CD molecules [BR:aml04090]
    100479765 (FZD10)
G protein-coupled receptors [BR:aml04030]
 Frizzled / Smoothened family
  100479765 (FZD10)
CD molecules [BR:aml04090]
 Proteins
  100479765 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100479765
NCBI-ProteinID: XP_002927184
LinkDB
Position
12
AA seq 581 aa
MPRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGLFPPLFRPQRPHSAQEH
SLRDAGPGRASCDNPGKFHHVEKSAACAPLCTPGVDVYWSRGDKRFAVVWLAVWAVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEAHSSYFHLAAWA
IPAVKTILLLVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVVGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMEYWKILAAQHK
CKMNNQTKSLDCVMAASIPAVEIFMVKIFMLLVVGITSGMWVWTSKTLQSWQNVCSRRFK
KESRRKPASVITNSGIYKKAQHPQKTHLGKYEIPAQPPTCV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgccgcgtccgggcccccgcctgtggctggtcctgcaggtgatgggttcgtgcgccgcc
atcagctccatggacatggagcgtccgggcgacggcaagtgccaacccatcgagatcccg
atgtgcaaggacattggctacaacatgacccgtatgcccaacctgatgggccacgagaac
cagcgcgaggccgccatccagctgcacgagttcgcgccgctggtggagtacggctgccac
ggccacctccgcttcttcctgtgctcgctgtacgcgcccatgtgcacagagcaagtctcc
acccccatccccgcctgccgggtcatgtgcgagcaggcccggctcaagtgctccccgatc
atggagcagttcaacttcaagtggcccgactccctggactgcagcaaactccccaacaag
aacgaccccaactacttgtgcatggaggcgcccaacaacggctcggacgagccctcccgg
ggctcgggcctgttcccgccgctcttccggccgcagcggccgcacagcgcgcaggagcac
tcgctcagggacgcgggcccggggcgcgccagctgcgacaacccgggcaagttccaccac
gtggagaagagcgcggcgtgcgcgccgctgtgcacgcccggcgtggacgtgtactggagc
cgcggcgacaagcgcttcgccgtggtctggctggctgtctgggccgtgctgtgcttcttc
tccagcgccttcaccgtgctcaccttcctcatcgacccagcgcgcttcaggtaccccgag
cgccccatcatcttcctctccatgtgctactgcgtctattcggtgggctacatcatccgc
ctgttcgcgggcgcggagagcatcgcctgcgaccgggacagcgggcagctctatgtcatc
caggaggggctggagagcacgggctgcaccctcgtcttcctggtcctctattacttcggc
atggccagctcgctgtggtgggtgattctcacgctcacctggttcctggctgcgggcaag
aagtggggccacgaggccatcgaggcccacagtagctacttccacctggcggcctgggcc
atcccggccgtcaagaccatcctgctcctggtgatgcgcagggtggcgggcgacgagctc
acgggcgtgtgctacgtgggcagcatggacgtgaacgccctcaccggcttcgtgctcatc
ccgctggcctgctacctggtcgtcggcacttccttcatcctctccggcttcgtggccctc
ttccatatccgcagggtgatgaagaccggtggggagaacaccgacaaactggagaagctc
atggtgaggattggagtcttctcggtgctctataccgtgccggccacctgtgtgattgcc
tgttacttttacgaacgcctcaacatggagtactggaaaatcctggccgcgcagcacaag
tgcaaaatgaacaaccagaccaaaagtctggactgcgtgatggccgcgtccatcccggcc
gtggagatcttcatggtgaagatcttcatgctgctggtggtgggcatcaccagcgggatg
tgggtctggacgtccaagaccctgcagtcctggcagaacgtttgcagccgcaggttcaag
aaggagagcaggaggaagcccgccagcgtcatcaccaacagtgggatttacaaaaaagcc
cagcatccccaaaaaacccatctcgggaaatatgaaatccctgcccagcctcccacctgt
gtgtga

KEGG   Ailuropoda melanoleuca (giant panda): 109489608
Entry
109489608         CDS       T01329                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04916  Melanogenesis
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109489608 (FZD7)
   04390 Hippo signaling pathway
    109489608 (FZD7)
   04150 mTOR signaling pathway
    109489608 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109489608 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109489608 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109489608 (FZD7)
   05205 Proteoglycans in cancer
    109489608 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109489608 (FZD7)
   05226 Gastric cancer
    109489608 (FZD7)
   05217 Basal cell carcinoma
    109489608 (FZD7)
   05224 Breast cancer
    109489608 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109489608 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    109489608 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109489608 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109489608 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aml04030]
    109489608 (FZD7)
G protein-coupled receptors [BR:aml04030]
 Frizzled / Smoothened family
  109489608 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 109489608
NCBI-ProteinID: XP_034510862
LinkDB
Position
2
AA seq 606 aa
MRRAAAPPQIQASPGCLVALLRLRAPLHPWPAMPGSGAAASRSPLGLCTLVLALLGALAA
GAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYP
LVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRC
ENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYMPDLPFTALPPGAADGRGRAAFPF
SCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCAST
LFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVA
QGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAV
PAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLF
RIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTC
KSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSS
KGETAV
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgcgccgggcggccgcgcctcctcaaatccaagcctctcccggctgcctcgtcgcgctc
ctccggctgagagcgccgctgcacccgtggccggcgatgccgggctccggcgcggccgcg
tcgcgctcgcccctgggcctgtgcaccctggtgcttgcgctgctgggcgcgctggccgcc
ggcgccggggcgcagccttaccacggcgagaagggcatctcggtgccggaccacggcttc
tgccagcccatctccatcccgctgtgcacggacattgcctacaaccagaccatcctgccc
aacctgctaggccacacgaatcaagaggacgcgggcctcgaggtacaccagttctacccg
ctggtgaaggtgcagtgttctcccgaactgcgcttcttcttgtgctctatgtacgcaccc
gtgtgcaccgtgctggatcaggccatccctccgtgccgctctctgtgcgagcgtgcccgc
cagggctgcgaagcgctcatgaacaagttcggcttccagtggcccgagcggctgcgctgt
gagaactttcccgtgcacggcgcgggcgagatctgcgtgggccagaacacgtccgacggc
tccgggggcccgggcggcggccccacagcctaccccaccgcgccctatatgccggacctg
cccttcaccgcactgcccccgggggccgctgacggcaggggccgcgctgccttccctttc
tcgtgcccccgccagctcaaggtgcccccctacctaggctaccgctttctgggtgaacgc
gactgcggcgccccgtgcgagccaggccgtgccaacggcctaatgtactttaaggaggag
gagaggcgctttgcccgtctctgggtgggcgtgtggtcggtgctgtgctgcgcctcgacg
ctcttcacagtgctcacctatttagtggacatgaggcgcttcagctatcccgagcggccc
atcatctttctgtcgggctgctacttcatggtggcggtggcgcacgtggctggcttcctg
ctggaggaccgcgcggtgtgcgtggagcgcttctcagacgatggctaccgcacggtggcg
cagggcaccaagaaggagggttgcactatcctcttcatggtgctgtacttcttcggcatg
gccagttccatctggtgggtcatcctgtcgctcacttggttcctggcagccggcatgaag
tggggccatgaagccatcgaagccaactctcagtacttccacctggccgcgtgggccgtg
cccgctgtcaagaccatcaccatcttggccatgggccaggtggatggggacttgctcagt
ggggtgtgctacgtgggcctgtccagcgtggatgcgctgcggggcttcgtcctggcgcct
ctgttcgtctacctcttcattggcacgtccttccttctggccggcttcgtgtcgctcttc
cgcatccgcaccatcatgaagcacgacggaaccaagaccgagaaactggagaagctcatg
gttcgcatcggcgtcttcagcgtgctctacacggtgccggcaaccatcgtcctggcctgc
tacttctatgagcaggccttccgcgaacactgggagcgcacctggctcctgcagacgtgc
aagagctacgcggtgccctgcccgcctggccatttcccgcccatgagccccgacttcact
gtcttcatgatcaagtacctgatgaccatgatcgtgggcattaccaccggcttctggatc
tggtccggcaaaactctgcagtcgtggcgccgcttctaccacagactcagccacagcagc
aagggggagactgcggtatga

DBGET integrated database retrieval system