KEGG   Ailuropoda melanoleuca (giant panda): 100465768
Entry
100465768         CDS       T01329                                 

Gene name
APC2
Definition
(RefSeq) LOW QUALITY PROTEIN: adenomatous polyposis coli protein 2
  KO
K02085  adenomatosis polyposis coli protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04810  Regulation of actin cytoskeleton
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100465768 (APC2)
   04390 Hippo signaling pathway
    100465768 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100465768 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100465768 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100465768 (APC2)
   05206 MicroRNAs in cancer
    100465768 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100465768 (APC2)
   05225 Hepatocellular carcinoma
    100465768 (APC2)
   05226 Gastric cancer
    100465768 (APC2)
   05217 Basal cell carcinoma
    100465768 (APC2)
   05213 Endometrial cancer
    100465768 (APC2)
   05224 Breast cancer
    100465768 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100465768 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    100465768 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100465768 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100465768 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100465768 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100465768 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aml04812]
    100465768 (APC2)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100465768 (APC2)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100465768 (APC2)
Cytoskeleton proteins [BR:aml04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100465768 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC APC_r Arm Suppressor_APC Arm_APC_u3 HALZ bZIP_1 Sec7_N
Other DBs
NCBI-GeneID: 100465768
NCBI-ProteinID: XP_034513274
LinkDB
Position
4
AA seq 2268 aa
MTSSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKEVLKHLQAKLEQE
AGVLVSLGQTEVLEQLKALQTDITSLYNLKSQPPALGPEPPARTPEESPVHGSGPSKDSF
GELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETQFSMQM
DLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDQELLSAQDRVQQTEPQA
LLAVKSVSVDEDPETEVPTHPEDGVPPPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSS
SPESCVAMRRSGCLPLLLQILHGVEAGAGGRSASPGAPGAKDARMRANAALHNIVFSQPD
QGLARKEMRVLHVLEQIRAYCETCWDWLQARDSADGGGNSGAPVPIEPQICQATCAVMKL
SFDEEYRRAMNELGGLQAVADLLQVDYEMHKTTRDPLNLALRRYAGMTLTNLTFGDVANK
AALCARRGCMEAIVAQLASESEELHQVVSSILRNLSWRADINSKKVLREVGSMTALMQCV
LRASKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIESGG
GILRNVSSLVATREDYRQVLRDHHCLQTLLQHLTSHSLTIVSNACGTLWNLSARSARDQE
LLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKYQTTATAISPGACAPSLYVR
KQRALEAELDTRHLAQALDHLEKQGLPEAEADPASKKPLPPLRHLDGLARDYASDSGCFD
DDEAPSLAAAATTVEPASPAVLSLFLGSPFLQGQALARAPPARRSGLEAEKEAGGEVAVA
ARAKAKLALAVARIDRLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRRPEG
RRQEAGGRAHPLLRLKAAHASLSNDSLNSGSTGDGRCPREHTRPCPLAVLTEHREGSPCS
QVRPSRLDLHLPGSQEPASRDASAADACVRTIKLSPTYQHVPLFEGNPRAGTAPLAPGAR
KQAWPPTDGLSKVPERLVAETVPLCLSRCSSLSSLSSAGRPGPSEAGDLDSDSSLEGLEE
AGPSKADLDGAWLGPGATSLPVAIPAARRGRGLGVEDTTPSSSSENCVQETPLVLSRCSS
VSSLSSFESPSIASSVPSDPCSGLGSGTVSPSELPDSPGQTMPPSRSKTPPLAPVPPGER
ESTQFSLQWESYVKRFLDIADRRERCRLPSELDAGSVRFTVEKPDENFSCASSLSALALH
EHYVQKDVELRLLPPACPERGGGGGGPGGPGLHFAGHRRRDEAGGCLEGPAAADQELELL
RECLGAAVPARLRKVASALVPSRRALPVPVYMLVPAPARVDESCADSTEGTPVTFSSATS
LSDETLQGPPRDPPGGHSDRQKPAGREAPARQATGQRHRAWGAGRSTEQARGAGRSRAGL
ELPLRRPSSACTDRDSSRPSPARGDGALRSLCLTTPTEEAVYCLYDDSDKEPSEAAAPPR
RASAIPRAAKRARPAGRKEVPAAPKATPKATHAARAQPSLIADETPPCYSLSSSASSLSE
PEPPERPASRPHAPEPAVHKVPGTGGGSNGPPSPRAETGLLRRSVGSAVPRCRLQASGLR
RRKPQVAQPDKRPAEGPRERGDEAAGSDHASDLDSVEWRAIQEGANSIVTWLHQAAAAAT
REASSGSDSVLSGSGLSGSSTLQPPLHRKGRRLQAGGQAGSAARPEKRDSALAQHSTSGP
EKLRGAQKTACRVPAVLRGRTVIYVPSPAPRAQPKGNAGSRVAPRKMGPPSPAQPAAPAK
TPSPGQQRSRSLHRPGKISELAALSPPQRSATPPARLAKAPSSGSSPASPASQPPTKRPP
PGAQASGPLPGPGASLVPRTPTRALLSKQHKTQKSPVRIPFMQRPARRGPPPLARAAPEP
GPRGRAAAEGSPNTRGARLGLVRVASARSSGSESSDRSGFRRQLTFIKESPGLLRRRRME
LSAPDATPPASQGGSPRRGRPALPAVFLCSSRCDELRAAPRQVSVPQRTPAAGPSPGERP
ARRPSSESPSRLPVRTPATRPEAVKRYASLPHISVARRPDGATPRPTADAARRSSDGEAR
PLPRVAAPGTTWRRIRDEDVPHILRSTLPATALPLMGAPSEEGPHGPPQRKTSDAVVQTE
DFAATKTNSSTSPSLESRGPPQAPVNGPTTLPGSDVDGPGPTKAPASAPFVHEGLGVAAG
GFPASRHGSPSRSVRVPPFNYVPSPMVAATTDLATEKAPTAAPASLRE
NT seq 6807 nt   +upstreamnt  +downstreamnt
atgacgagctccgtggcaccatacgagcagctggtgcggcaggtggaggccttgaaggcc
gagaacagtcacctgaggcaggagctgcgcgacaattccagccacctgtccaagctggag
acggagacgtccggcatgaaggaggtcctgaagcacttacaagccaagctggagcaggag
gctggagtgctggtgtccttggggcagaccgaggtgctggagcagctgaaagccctgcag
acggacatcaccagcctgtacaacctgaagtcccagccccccgccctgggccccgagccc
cctgcacggacccccgaagaaagtcccgtccacggctctgggccctctaaggacagcttt
ggggagctgagccgggctaccatccggctcctggaggagctggaccgcgaacggtgtttc
ctgttgaacgagatcgagaaggaggagaaggagaagctctggtattactcacagctgcag
ggcctgtccaagcgcctggacgagctcccgcacgtggagacgcagttctcgatgcagatg
gacctgatccggcagcagctggagttcgaggcccagcacatccgctcgctgatggaggag
cgcttcggcacctcggacgagatggtgcagcgggcgcagatccgtgcttcgcgcctggag
caaatcgatcaggaactgctgtcggcgcaggaccgcgtgcaacagaccgagccccaggcc
ctgctggcggtgaagtcagtgtcggtggacgaggacccagagactgaggtccccacgcac
cctgaggatggcgtccctccgccaggcaacagcaaggtggaggtggtcttctggttgctg
tccatgctggcgacgcgggaccaggaggacacagcccgcaccctgctggcgatgtccagc
tctccggagagctgcgtggccatgcgccgctcggggtgcctgccgctgctgctacagatc
ctgcacggcgtggaggctggcgctgggggtcggagtgcgagccccggggcgccgggagcc
aaggatgcgcgcatgcgcgccaacgcggcactgcacaacattgtcttctcgcagccggac
cagggcctggcgcgcaaggagatgcgcgtcctgcacgtgctggagcagatccgggcctac
tgtgagacgtgctgggactggctgcaggcccgggacagcgccgacggaggcggcaacagc
ggcgctccggtccccattgagcctcagatctgccaggccacctgtgctgtgatgaaactg
tcctttgacgaggaataccgccgtgccatgaacgagctgggtgggctgcaggccgtagcg
gacttgctgcaggtggactacgagatgcacaagacgacgcgggacccgctcaaccttgcc
ctccgccgatatgctggcatgaccctcaccaacctcaccttcggggatgtcgccaacaag
gccgcgctgtgtgcccgccggggctgcatggaggccatcgtggcccagctggcttccgag
agcgaggagctccaccaggtggtgtccagcatcctgcgtaacctgtcctggcgagctgac
atcaacagcaagaaggtgctgagggaggtcggcagcatgactgccctgatgcagtgtgtt
ctgcgagcctccaaggagtccaccctgaagagtgtgctcagcgccctgtggaacctgtca
gcacacagcactgagaacaaggcggccatctgccaggtggacggcgcgctgggcttcctg
gtgagcacactgacctacaagtgtcagagcaactccctggccatcatcgagagcggcggc
ggcatcctgcgcaacgtgtccagcctcgtggccacccgggaggactacagacaggtgttg
cgggaccaccactgcctgcagacgctgctccagcacctgacgtcgcacagcctgaccatc
gtgagcaacgcctgcggcacgctctggaacctgtccgcccgcagcgcgcgtgaccaggag
ctgctgtgggacctgggcgccgtgggcatgctgcgcaacctggttcactccaagcacaag
atgatcgccatgggcagcgccgccgccctgcgcaacctgctggcccaccggccggccaaa
taccagacgacggccacggccatctccccgggcgcctgcgcacccagcctgtacgtgcgg
aagcagcgggcgctggaggccgagctggacacgcggcacctggcgcaggcgctcgaccac
ctggagaagcagggcctgcccgaggcggaggccgaccccgcctccaagaagccgctgccg
cccctgcgacacctggacgggctggcccgggactacgcctcggactcgggctgctttgac
gacgacgaggcgccctccctggctgccgcggccaccaccgtggagcccgccagccctgcc
gtgctgtcactcttcctggggagccccttcctgcaggggcaggcgctggcccgagcccca
cctgcccgccgcagcggcctggaggcggagaaggaggccggcggggaggtggccgtggcg
gccagggccaaggccaagctggcactggcggtggcgcggatcgaccggctggtggaggac
atctccgccctacacacctcgtctgatgacagcttcagcctcagctctggggaccccggg
caggaggcgccgcgcgaaggtcgggcccagtcctgctccccttgccggcggcccgagggc
aggcggcaggaggctggcggccgtgcccacccactgctgcggctgaaggctgcccacgcc
agcctctccaacgacagtctcaacagcggcagcaccggtgacgggcgctgtccccgcgag
cacacgcggccctgcccactggccgtgctgaccgagcaccgcgaggggtccccgtgcagc
caggtgcggcccagccggcttgacctccatctgccgggcagccaggagccagcatcccga
gacgcctctgccgcagacgcctgcgtgcgcaccatcaagctgtcgcccacctaccagcac
gtgccgctcttcgagggcaaccccagggcgggcacggcgcccctggcccccggagcccgg
aagcaggcctggccgcccacggacggcctgagcaaggtgccggagaggctggtggcagag
acagtgccgctctgcctgtcccgctgcagctccctgtcctcgctgtcctcggctggccgc
ccaggccccagcgaggccggggacctggacagcgactcatccctggaagggctggaggag
gcaggacccagcaaggcagacctggacggggcctggctcgggcccggggccacttccctg
cctgtggccatcccagcggcccggcggggccggggcctgggggtcgaggacaccacgccg
tccagctcctcggagaactgtgtgcaggagacgccgctggtactgagccgctgcagctcg
gtgagctccctgagcagtttcgagagcccgtccatcgccagctctgtccccagcgaccca
tgcagtgggctgggcagcggcacggtcagccccagtgagctgcctgacagccccgggcag
accatgccccccagccgcagcaagacgcccccgctggcccctgtgccccccggcgagcgc
gagagcacccagttcagcttgcagtgggagagctacgtgaagcgcttcctggacatcgca
gaccgccgcgagcgctgccggcttccgtctgagctggacgcgggcagcgtgcgcttcacc
gtggagaagcccgacgagaacttctcatgcgcttccagcctcagcgcgctggccctgcac
gaacactacgtgcagaaggacgtggagctgcggctgctgcccccggcctgccctgagcgc
ggcggtggcggcggtggccccggcggccccggcctgcactttgctgggcaccgccggcgg
gacgaggctggtggctgccttgaggggccggcagccgccgaccaggagctggagctgctg
cgtgagtgcctgggagcggcggtgcccgcccggctccgcaaggtggcctcggccctcgtg
cccagccgccgcgcactgcccgtgcccgtctacatgctggtgcctgcccctgcccgggtg
gacgagtcctgcgccgactccaccgagggcacgcctgtcaccttctccagtgccacctca
ctcagtgacgagacactgcagggacctcccagggacccgccaggcgggcattcggacagg
cagaagcctgcaggtcgtgaggcccctgccaggcaggccaccgggcaaaggcacagggcg
tggggcgcaggccggagcacggagcaggcccggggagcgggcagaagccgggcagggctg
gagctgcccctccgccggccctcgagcgcctgcacggaccgggacagctcccgccccagc
cctgcacgcggggacggggcgctgcggtcactgtgcctcacgacgcccaccgaggaggcc
gtctactgcttgtacgacgactcagacaaggagccgtccgaggcagcggcacccccgcgg
cgggcgtccgccatcccccgtgcggcgaagagagcgcgcccggctggccggaaggaggtg
ccagccgcacccaaggctacgcccaaggccacacacgccgcccgcgcccagcccagcctc
attgccgacgagacgccgccgtgctactccctgagctcctccgccagctccctcagcgag
cctgagccccctgagcgcccggccagccggccccatgctcctgagccagctgtccacaag
gtcccaggcactgggggtgggtctaatggccccccaagcccacgggcggagacagggctg
ctccggcgcagcgttggctccgcggtgcccagatgccggctccaggcgtcaggcctacgg
cgccgcaagccccaagttgcccagccagacaagcggccagcagaggggccccgggagcgc
ggggacgaggcggcaggctcagaccacgcctcagaccttgacagcgtcgagtggcgtgcc
atccaggagggcgccaactccattgtcacatggctgcaccaggcggcggcagcggccacc
cgtgaggcgtcgtccgggtctgactctgtcctgtctgggtcggggctgtcggggagctcc
accctgcagccccccctgcacaggaagggacggcggcttcaggctgggggccaggcgggc
agtgccgcgaggccggagaaacgggactcggccctggcccagcacagcaccagtggcccc
gagaagctgcgtggtgctcagaagactgcatgcagggtgccggcggtgctccggggacgg
accgtgatctatgtgcccagcccggcccctcgggcccagcccaaaggcaacgctggcagc
cgcgtggcaccgaggaagatgggcccccccagtcctgcgcagccagcagctcccgccaaa
acccccagtcctgggcagcagcggtctcgaagcctgcaccggccaggcaagatctcggag
ctggcggcactgagccctccccagaggagcgccacaccacccgcccgcctggcgaaggcc
ccctcatccggctcctccccggcctctccggcctcccagcctcctacgaagaggccgccc
ccaggggcccaggcctcagggcccctccccggccccggggcatctctggtgccccgaaca
cccacacgggccctgctgtccaagcagcacaagacacagaagtcacccgtgcggatcccc
ttcatgcagaggccagccaggcgtgggccgccacccctggccagggcagccccggagcca
ggcccccggggtcgggcggcagctgagggaagccccaacacccgaggggcccgcctgggg
ctggtgcgcgtggcttcagcccgctccagtggcagcgagtcctccgaccgctcgggtttc
cggcggcagctgacctttatcaaggagtccccgggcctgctgcgccgccgccgcatggag
ctgtccgccccggacgccacaccccccgcctcccagggcggctcgccccgccgcgggcga
cctgcgctgcctgccgtcttcctctgctcctcgcgctgcgacgagctgcgggcagccccc
aggcaggtttcggtcccccagcgaacccccgcggccgggcccagtcccggcgagcggcca
gcccggcgccccagctccgagagcccgtcccgcctgcctgtccgcaccccggccacccgg
cccgaggcggtcaagcggtacgcctccctgccgcacatcagcgtggctcgcaggcctgac
ggggccacccccaggcccaccgctgacgccgcccgccgcagcagcgatggggaggcccgg
ccgctgccaagggtggcggcgccaggcaccacgtggcgtcgcatccgggacgaggacgtt
ccacacatcctgcggagcacgctgcctgccactgccctgccactgatgggagccccgtcc
gaggagggcccccacggccccccacagcgcaagaccagtgatgccgtggtccagacagag
gactttgctgccaccaagaccaactccagcacatctcccagcctggaaagcagggggccc
ccccaggccccagtcaacgggcccaccaccctccctggcagtgatgtggacgggcccggc
cccaccaaggctcccgcctctgctccctttgtccatgagggcctgggggtggctgcaggg
ggctttcccgccagccggcacggctcccccagccgctcagtccgtgtcccccccttcaac
tacgtgcccagccccatggtggcagccaccacggacttggccacagagaaagcccccacc
gctgcccccgccagcctccgggaatag

KEGG   Ailuropoda melanoleuca (giant panda): 100472257
Entry
100472257         CDS       T01329                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein isoform X5
  KO
K02085  adenomatosis polyposis coli protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04810  Regulation of actin cytoskeleton
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100472257 (APC)
   04390 Hippo signaling pathway
    100472257 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100472257 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100472257 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100472257 (APC)
   05206 MicroRNAs in cancer
    100472257 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100472257 (APC)
   05225 Hepatocellular carcinoma
    100472257 (APC)
   05226 Gastric cancer
    100472257 (APC)
   05217 Basal cell carcinoma
    100472257 (APC)
   05213 Endometrial cancer
    100472257 (APC)
   05224 Breast cancer
    100472257 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100472257 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    100472257 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100472257 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100472257 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100472257 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100472257 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aml04812]
    100472257 (APC)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100472257 (APC)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100472257 (APC)
Cytoskeleton proteins [BR:aml04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100472257 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_u15 APC_rep APC_u9 APC_N_CC SAMP Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII
Other DBs
NCBI-GeneID: 100472257
NCBI-ProteinID: XP_011223207
Ensembl: ENSAMEG00000012636
UniProt: D2HBD2
LinkDB
Position
3
AA seq 2844 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIDNEAM
ASSGQTDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RGFVNGSRENTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRVTRIQQIEKDILRIRQLLQPQAT
EAERSSQSKHEAGSHEAERQNEGQGMADINMAASGSGQGSTTRMDHETASVLSSGSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ
VDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL
QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT
ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENN
CLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAM
GSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLS
PKASHRNKQRHKQSLYSDYGFDTNRHDDNRSDNFNAGNMTVLSPYLNTTVLPSSSSSRGS
LDSSRSEKDRSLERERGISLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTS
QEDRSSGSTTELHCGTDERNALRRSSTAHTHASTYNFSKSENSNRTCPLPYAKLEYKRSS
NDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGE
LDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRSQGTTYPVYTE
STDDKHLKFQPHFGQQECVSPYRSGGASGSETNRVGSNHGINQNVNQSLCQEDDYEDDKP
TNYSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDITSSQKPPFSFSKN
PSGQSTKTEHISSSSENTSTPSSNAKRQNQHHPSSAQSRNGQTPKATSCKVPSINQETIQ
TYCVEDTPICFSRCSSLSSLSSAEDEIGCDQATQETDSANTLQIAEIKENSGTRTTEDSV
SEVPTVSQHIRTKSSRLQASGLSAESTRHKAVEFSSGAKSPSKSGAQTPKSPPEQYVQET
PLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPP
PPPQSVQTKREVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGF
SCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPEEANENQEKETEKPTDSE
KDLLDDSDDDDTEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPS
QNRLQAQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRAAAQ
AREFEKRDTIPTEGRSTDEAQRGKTPSVTIPELDDSKTEEGDILAECINSAMPKGKSHKP
FRVKKIMDQVQQASMSSSGANKNQLDGKKKKPTSPVKPMPQNTEYRTRVRKNTDSKNNVN
AERTFSDNKDSKKQNLKNNAKDFNDKLPNNDDRVRGSFTFDSPHHYTPIEGTPYCFSRND
SLSSLDFDDDDVDLSREKAELRKGKENKESEAKVTSHTELTSNQQSANKTQAVTKHPINR
GQSKPMLQKQSTFPQSSKDIPDRGAATDEKLQNFALENTPVCFSRNSSLSSLSDIDQENN
NNKANEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLL
QECISSAMPKKKKPSRLKGDNEKHSPRNMSGILAEDLTLDLKDIQRPDSEHGLSPDSENF
DWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPF
TSNKGPRILKPGEKSTLETKKIESENKGIKGGKKVYKSLITGKVRSHSEVSSQMKQPLQA
NMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVK
SELSPVTRQTSQPAGANKGPSRSGSRDSTPSRPAQQPLSRPMQSPGRNSISPGRNGISPP
NKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQPGLSKNGSSIPRSESASK
GLNQVNNSNGPNKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEES
ASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHSSVQSGGWRKLPPNLSPTIEYND
GRPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSE
SSEKAKSEDEKHVNSISGTKQTKENQVSTKGTWRKIKESEISPTNSTSQTTSLGAANGAE
SKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDTVSEKGNPNVKDAKD
NQGKQNVGNGSAPVRTMGLENRLNSFIQVDGPDQKGTEAKPGQSNPVPASEANGSSVAER
TPFSSSGSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVSNNAKKRDSK
TDSTESSGTQSPKRHSGSYLVTSV
NT seq 8535 nt   +upstreamnt  +downstreamnt
atggctgcggcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacagctacagggaagtattgacaatgaagctatg
gcctcttctggacagactgacttattagagcgcctcaaagaacttaacttagatagcagt
aatttccctggagtgaaactacggtcaaaaatgtccctccgttcttatggaagccgtgaa
ggatctgtatctagtcgttcaggagagtgcagtcctgttcctatgggttcatttccaaga
agagggtttgtaaacggaagcagagaaaataccggttatttagaagaacttgagaaagag
agatcattacttcttgctgatcttgacaaagaagaaaaggaaaaagactggtattatgct
caacttcagaatctcactaaaagaatagatagtctccctttaaccgaaaatttttcctta
caaacagatatgaccagaagacaattagaatatgaagcaaggcaaatcagagttgcaatg
gaagaacaactaggtacttgccaggatatggaaaaaagagcgcagcgaagagtaaccaga
atccaacagatagagaaggacatacttcgtatacgacagcttttacagccccaagcaaca
gaagcagagaggtcatctcagagcaagcatgaagccggctcacatgaagctgagcggcag
aatgaaggtcaaggaatggcagacatcaacatggcagcttctggtagtggtcagggttca
actacacgaatggatcatgaaacagccagtgttttgagttctggtagcacacactctgct
cctcgaaggttgacaagtcatctgggaaccaaggtggaaatggtgtattcattgttgtca
atgcttggtactcatgataaggatgatatgtcgcgaactttgctagctatgtctagctcc
caagacagctgtatatccatgcgacagtctggatgtcttcctctcctcatccagctctta
catggcaatgacaaagactctgtgttgttgggaaattcccggggcagtaaagaggctcgg
gccagggccagtgcagcacttcacaacatcattcactcacagcctgatgacaagagaggc
aggcgtgaaatccgagtccttcatcttttggaacagatacgagcttactgtgaaacctgt
tgggagtggcaggaagcccatgaacaaggcatggaccaggacaaaaatccaatgccagct
cctgttgaacatcagatctgtcctgctgtttgtgttctaatgaaactttcatttgatgaa
gagcatagacatgcaatgaatgaacttgggggactacaggccattgcagaattattgcaa
gtggactgtgaaatgtatgggctaactaatgaccactacagtattacattaagacgatat
gctgggatggctttgacaaacttgacttttggagatgtagccaacaaggctacactctgc
tctatgaaaggctgcatgagagctcttgtggcccaactaaaatctgaaagtgaggacttg
cagcaggttattgcaagcgttttgaggaatttgtcttggcgagcagatgtaaatagtaaa
aagacattgcgtgaagttggaagtgtgaaagcattgatggaatgtgctctggaagttaaa
aaggagtcaaccctgaaaagcgtattgagtgccttatggaacttgtcagcacattgcact
gagaataaagctgatatatgtgctgtggatggtgcgcttgcatttctggtcggcaccctc
acctaccgaagccagacaaatactttagccattattgaaagtggaggtgggatattacgg
aacgtgtccagcttgatagctacaaatgaggaccacaggcaaatcctaagagagaacaac
tgcctacaaaccttattacaacacttgaaatctcacagtttgacaatagtcagtaatgca
tgtggcactttgtggaatctctcagcaagaaatcctaaagaccaggaagcattatgggac
atgggggcagtcagcatgctcaagaacctcattcattcgaagcacaaaatgattgctatg
ggaagcgctgcagctttaaggaatctcatggcaaatagacctgcaaagtataaggatgcc
aatattatgtctcctggttcaagcttgccatctcttcatgtcagaaaacaaaaagcccta
gaagcagaattggatgctcagcatttatcagaaacttttgacaacattgacaatttaagt
cccaaggcatctcatcgtaataagcaacgacacaagcaaagtctctatagtgactatggt
tttgacaccaatcgacatgatgataacaggtcagacaattttaatgctggaaacatgact
gtcctttcaccgtatttaaatactacagtgttgcccagctcttcttcgtcaagaggaagt
ttagacagttctcgttctgaaaaagatagaagtttggagagagaacgaggaattagccta
ggcaactaccacccagcgacggaaaatccaggcacttcttcaaagcgaggtttgcagatt
tccaccactgcagcccagattgccaaagtcatggaagaagtatcagccattcacacctcc
caggaagacagaagttctgggtctaccaccgagttacactgtgggacagacgagaggaat
gcactaagaagaagctctactgcccacacacatgcaagcacttacaacttcagtaagtca
gaaaattcaaataggacatgtcctttgccttatgctaaattggaatataagagatcttca
aatgatagtttaaatagtgtcagtagtagtgatggttacggtaaaagaggtcagatgaag
ccttccattgaatcctattctgaggacgatgaaagtaaattttgcagctatggtcaatat
ccagctgacctagcccataaaatacatagtgcaaatcatatggatgacaatgacggagaa
ctagatacaccaataaactatagtcttaaatattcagatgagcagttgaactccggaagg
caaagcccttcacagaatgagagatgggcaagacccaaacatataatagaagacgaaata
aaacaaagtgagcaaagacaatcaagaagtcaaggcacaacataccccgtgtataccgag
agcacagatgataaacacctcaagttccaaccacattttggacagcaggagtgtgtttcc
ccctataggtcaggaggagccagtggttcagaaacaaatcgagtaggttctaatcatgga
attaatcaaaacgtaaaccagtctttgtgtcaagaagatgactatgaagatgataagcca
accaactatagtgaacgttactccgaggaagagcaacatgaggaagaagaaagaccaaca
aattatagcataaaatataatgaagaaaaacatcatgtggatcagcctattgattatagt
ttaaaatatgccacagacattacttcttcacagaaaccaccattttcattctcaaagaat
ccatctggacagagcactaaaaccgaacacatctcttcaagcagtgagaatacatccaca
ccttcgtctaatgccaagaggcagaatcagcaccatccaagttcagcacaaagcagaaat
ggtcagaccccaaaagccacctcctgcaaagttccctctatcaaccaagaaacaatacag
acttactgcgtagaggatacaccgatttgtttttctcgttgcagttcattatcctctttg
tcttcagctgaagatgaaataggatgtgatcaggcaacacaggaaacagattctgctaat
actctacaaatagcagaaatcaaagaaaacagcgggactagaacaacagaagattctgtg
agtgaagtcccaacagtatcacagcacattagaaccaaatccagcagacttcaggcttct
ggtttatctgcagaatcaaccaggcataaagctgttgaattttcttcaggggccaaatct
ccatcaaaaagtggggctcagacacctaaaagcccaccggagcagtatgtccaggagacc
ccactcatgtttagccggtgtacttcagtcagttcactcgatagctttgagagtcgttca
attgccagctccgttcagagtgaaccctgcagtggaatggtgagtggcattataagcccc
agtgaccttccagatagccctggacaaaccatgccaccaagccgaagtaagacccctccc
cctcctcctcagagtgttcaaactaagcgagaggtacctaaaaacaaagcccctactgcg
gaaaagcgagagagtggacctaagcaagctgctgtaaacgctgcggtacagagagtccag
gttctcccagatgctgacactctattacattttgccacagaaagtactccagatggattt
tcttgttcatctagcctgagtgctctgagcctcgatgagccatttatacagaaagatgtg
gaattaagaataatgcctccagttcaggaaaatgacaatgggaatgaaactgaatccgag
cagcctgaagaagcaaatgaaaaccaggaaaaagagacagaaaaacctactgattctgaa
aaagatctcttagatgactcagatgatgatgatactgaaatactagaagaatgtattatt
tctgccatgccaacaaaatcttcacgcaaagccaaaaaaccagcccagactgcttccaaa
ttacctccacctgtggcaaggaaaccaagtcagctccctgtgtacaaacttcttccatca
caaaacaggttacaagcgcaaaagcatgttagttttacgccgggagatgacatgccgcgg
gtatactgtgtagaagggacacctataaacttctccacagctacgtctttaagtgatcta
acgatagaatctcccccaaatgagttagctgctggagaaggggttagagcagcggcacag
gcaagggaattcgaaaaacgagataccattcctacagaaggcagaagtacagatgaggct
cagagaggaaaaaccccgtctgtaactatacccgagctggatgacagtaaaacagaagaa
ggtgatattctcgcagaatgcattaattctgctatgcccaaagggaaaagtcacaagcct
tttcgtgtgaaaaagataatggaccaggtccagcaagcatctatgtcttcatctggagct
aacaagaatcagttagatggtaagaaaaagaaacctacttcaccagtaaaacctatgcca
caaaatactgaatataggacacgtgtaagaaaaaatacagactcaaaaaataatgtaaat
gctgaaaggactttctcagacaacaaagattcaaagaaacagaacttgaaaaataatgcc
aaggacttcaatgataagctaccaaataatgacgatcgcgtcagaggaagttttactttt
gattcacctcatcactacacgcctattgaagggactccgtactgtttttcacgaaatgat
tctttgagttctctagattttgatgatgatgatgttgacctttccagggaaaaggctgaa
ttaagaaaggggaaagaaaataaggaatccgaagctaaagttaccagccacacagaacta
acctctaaccaacaatcagctaataaaacacaggctgttacaaaacatccaataaatcga
ggtcagtccaaacccatgctgcagaagcaatccacttttccacagtcatccaaagacata
ccagacagaggagcagcaactgatgagaaattacagaattttgctcttgaaaatactcca
gtgtgcttttctcgaaactcctctctaagttctcttagtgacattgatcaagaaaacaac
aataacaaagcaaatgaacctatcaaagagacagagccccctgactcacagggagaacca
agtaaacctcaggcatcaggttacgctcctaaatcatttcacgttgaagatacccctgtt
tgtttctcaagaaacagttctctcagttctctcagtattgattctgaagatgacctgttg
caggaatgtataagttctgcaatgccgaaaaagaaaaagccttcaagacttaagggtgat
aatgaaaagcatagtcccaggaatatgagtggcatattagcagaagatttgacactcgat
ttgaaagatatacagagaccagattcagaacatggtttatccccggattcagaaaatttt
gattggaaagctattcaagaaggtgcaaattccatagtaagtagtttacatcaagctgcc
gctgctgcctgtttatctagacaagcttcatctgactcagattccatcctttcactgaaa
tcaggaatctctctgggatctccatttcatcttacacctgatcaagaggaaaagcccttt
accagtaataagggcccacgaattctaaaacctggggagaagagtacattggaaactaaa
aagatagaatctgaaaataaaggaatcaaaggagggaagaaagtttataaaagtttaatt
actggaaaagttcgatctcattcagaggtttcaagccaaatgaaacagccccttcaagca
aacatgccttcaatctctcgaggcaggacaatgattcatattccaggagttcgaaatagc
tcttcaagtacaagtccagtttctaaaaaaggcccaccccttaagactccagcctccaaa
agccctagcgaaggtcagacagccaccacttctcctagaggagccaagccatcagtgaag
tcagaattaagccctgtaaccaggcagacatcccaaccagctggggcaaataaagggcct
tctagatcaggatctagagattccactccttcaagacctgcccaacaaccgttaagtaga
cccatgcagtctccagggcgaaactcaatttctcctggtagaaatggaataagtcctcct
aacaaattatctcagttgccaaggacttcatcccctagtaccgcttcgactaagtcctcg
ggttctgggaagatgtcatacacatctccaggcagacagatgagccagcagaaccttacc
aaacaaccaggcttatccaagaatggcagtagtatcccaagaagtgagtctgcctccaaa
ggactaaatcaggtgaataatagcaatggacccaataaaaaggtggaactttctagaatg
tcctcaactaaatcaagtggaagtgaatctgataggtcagagagacctgtattagtacgc
cagtcaactttcatcaaagaagctccaagcccaaccctaaggagaaaattggaggaatct
gcttcatttgaatctctttctccatcttctagaccagattctcccactaggtcccaggca
cagactccagttttaagtccttcccttcctgatatgtctctgtccacacattcgtctgtt
cagtctggtggatggcgaaaactcccacctaatctcagtcccaccatagagtataatgat
ggaagaccagcaaagcgccatgatatagcacgctcccattctgaaagtccttctagactt
ccgattaataggtcaggaacctggaaacgtgagcacagcaaacattcatcatcccttcct
cgagtaagcacttggagaagaactggaagttcatcttcaattctttctgcttcatcagaa
tccagtgaaaaggcgaaaagtgaggatgaaaaacatgtgaactctatttcaggaaccaaa
caaactaaagaaaaccaagtatccacaaaaggaacatggagaaaaataaaagaaagtgag
atttctcccacaaatagtacctctcagaccacttccttaggtgctgcaaatggtgctgaa
tcaaagactctaatttatcaaatggcacctgctgtttctaaaacagaggatgtttgggtg
agaattgaggactgtcccattaacaaccctagatccggaagatctccaacaggaaatact
ccccctgtgatcgacactgtttcagaaaagggaaatccaaacgttaaagatgcaaaagat
aatcagggaaaacaaaatgtgggtaatggcagtgctcccgtacgcaccatgggtttggaa
aaccgcctgaactcctttattcaggtagatggcccagaccaaaaaggaactgaggcaaaa
ccgggacaaagtaaccctgtccctgcatcagaggctaatggaagttctgtagctgagcgc
acaccgttcagttctagcggctcaagcaagcacagctcacctagtgggactgttgctgcc
agagtgacccctttcaattacaacccgagccctcggaagagcagtgcagatagcacttca
gcacggccgtctcagatcccgacaccagtgagcaacaacgcaaagaaacgagattcaaaa
actgacagcacagaatccagtggaactcaaagtcctaagcgccattctgggtcttacctt
gtgacatctgtgtaa

DBGET integrated database retrieval system