KEGG   Ailuropoda melanoleuca (giant panda): 100466345
Entry
100466345         CDS       T01329                                 

Gene name
JUP
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05221  Acute myeloid leukemia
aml05226  Gastric cancer
aml05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100466345 (JUP)
   05202 Transcriptional misregulation in cancer
    100466345 (JUP)
  09162 Cancer: specific types
   05226 Gastric cancer
    100466345 (JUP)
   05221 Acute myeloid leukemia
    100466345 (JUP)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100466345 (JUP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100466345 (JUP)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100466345 (JUP)
SSDB
Motif
Pfam: Arm HEAT Cnd1 HEAT_2 Adaptin_N DUF3361 Atx10homo_assoc Arm_2 PUL
Other DBs
NCBI-GeneID: 100466345
NCBI-ProteinID: XP_002922164
Ensembl: ENSAMEG00000005649
UniProt: D2HIR6
LinkDB
Position
13
AA seq 744 aa
MEVMNLVEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLRKTTT
YTQVPQSQGDLEYQMSTTARAKRVREAMCPGVTGEDSSLLLATQVEGQSTNLQRLAEPSQ
LLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMG
SPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVES
VLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQE
SKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHL
TSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCN
SSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYG
IPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRH
VAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQ
RVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYR
KRVSVELTNSLFKHDPAAWEAAQNMIPINEPYADDMDATYRPMYSSDAPLDPLDMHMDMD
GDYPIDTYSDGLRPPYPTADHMLA
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggaagtgatgaacctggtcgaacagcccatcaaggtgactgagtggcagcagacatac
acctatgactctggcatccactcgggtgccaacacctgtgtgccctcagtcagcagcaag
ggcatcatggaagaggatgaggcctgcgggcgccagtacacactcaggaagaccaccacc
tacacgcaggtgccccagagccaaggcgacctggagtaccagatgtccacgacggccaga
gccaagcgggtgcgggaggccatgtgtcctggcgtgacaggggaagacagctcgctgctt
ctggccacccaggtggagggccagagcaccaacctgcagcggctggctgagccgtcccag
ctgctcaagtcggccatcgtgcatctcatcaactaccaggatgacgccgagctggccacc
cgggccctgcctgaactcaccaaactgctcaacgatgaggacccggtggtagtgaccaag
gcagccatgattgtaaaccagctgtccaagaaagaggcgtcgcggcgggcgctgatgggc
tcgccccagctggtggcggccgtggtacgtaccatgcagaacacgagtgacctggacacg
gcccgctgcaccaccagcatcctgcacaacctgtcccaccaccgcgaggggctgcttgcc
atcttcaaatcaggtggcatccctgccctggtccgcatgctcagctcccccgtggagtcg
gtcctgttctatgccatcaccacgctgcacaacctgctgctgtaccaggagggtgccaag
atggcggtgcgcctggcagatgggctgcagaagatggtgcccctgctgaacaagaacaac
cccaagttcctggccatcaccacggactgcctgcagctcctggcctatggcaaccaggag
agcaagctcatcatcctggccaacggaggaccccaggccctcgtgcagatcatgcgtaac
tacagttatgagaagctgctctggaccaccagccgtgtgctcaaagtgctgtctgtgtgt
cccagcaataaacctgctatcgtggaggccggtggaatgcaggccttgggcaaacacctg
acaagcaacagcccccgcctcgtacagaactgcctctggaccctgcgcaacctctcggac
gtggccaccaaacaggagggcctggagagcgtgctgaagattctggtgaaccagctgagc
gtggacgacgtcaacgtcctcacctgtgccacgggcactctgtccaacctgacgtgcaac
agcagcaagaacaagacgctggtgacccagaacagcggcgtggaggcgctcatccacgcc
atcctgcgagccggcgacaaggacgacatcacggagcccgccgtctgcgccctgcgccac
ctcaccagccgccaccccgaggccgagatggcccagaactccgtgcgcctcaactacggc
atcccggccatcgtcaagctgctcaaccagcccaaccagtggccgctggtcaaggcaacc
attggcctgatcaggaacctggccctgtgcccagcaaaccatgccccgctgcaggaggcc
gcggtcatcccccgcctcgtccagttgctggtcaaggctcaccaggatgcccagcgccac
gtggctgcgggcacacagcagccctacacggacggtgtgaggatggaggagattgtggag
ggctgcaccggagccctgcacatcctggcccgggatcccatgaaccgcatggagatcttc
cgactcaacaccattcccctgttcgtacagctcctgtactcgtcagtggagaacatccag
cgtgtggctgccggggtcctgtgtgagctggcccaggacaaggaggctgctgatgccatt
gatgctgagggggcctcggccccgctcatggagctcctgcactcccgcaacgagggcacc
gccacctacgcggctgctgtcctgttccgtatctccgaggacaagaacccagattaccgt
aagcgcgtgtctgtggagctcaccaactccctcttcaagcatgacccagctgcctgggag
gctgcccagaacatgatccccatcaatgaaccctatgcagatgacatggatgccacctac
cgccccatgtactcgagcgacgcgcccctggaccccctggacatgcacatggacatggac
ggggactatcccatcgacacctacagcgatggcctgcggcccccctaccccacggcagac
cacatgctggcctag

DBGET integrated database retrieval system