KEGG   Ailuropoda melanoleuca (giant panda): 100466609
Entry
100466609         CDS       T01329                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04015  Rap1 signaling pathway
aml04062  Chemokine signaling pathway
aml04510  Focal adhesion
aml04666  Fc gamma R-mediated phagocytosis
aml04722  Neurotrophin signaling pathway
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04935  Growth hormone synthesis, secretion and action
aml05100  Bacterial invasion of epithelial cells
aml05135  Yersinia infection
aml05163  Human cytomegalovirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05211  Renal cell carcinoma
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100466609 (CRKL)
   04012 ErbB signaling pathway
    100466609 (CRKL)
   04015 Rap1 signaling pathway
    100466609 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100466609 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100466609 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100466609 (CRKL)
   04062 Chemokine signaling pathway
    100466609 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100466609 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    100466609 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100466609 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100466609 (CRKL)
   05206 MicroRNAs in cancer
    100466609 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100466609 (CRKL)
   05211 Renal cell carcinoma
    100466609 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100466609 (CRKL)
   05100 Bacterial invasion of epithelial cells
    100466609 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100466609 (CRKL)
   05163 Human cytomegalovirus infection
    100466609 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:aml04990]
    100466609 (CRKL)
Domain-containing proteins not elsewhere classified [BR:aml04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100466609 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 100466609
NCBI-ProteinID: XP_002926331
Ensembl: ENSAMEG00000008705
UniProt: D2HUK7
LinkDB
Position
14
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRIGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSSTPGAAINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcttcagaccgctccgcttggtacatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggtatgttcctagttcgcgat
tcctccacctgccccggggattatgtgctgtccgtgtcggagaactcgcgggtctcccac
tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggagtttgaccac
ttgccggccctgctggagttctacaagatccactacctggacaccaccaccctaatcgag
cccgcgcccaggtacccgagcccaccaatgggatctgtatcagcacccaacctgcctaca
gcagaagaaaatctggaatatgtacggactctctatgattttcctgggaatgatgctgaa
gacctgccctttaaaaagggtgagatcctggtgataatagagaagcctgaagaacagtgg
tggagcgcccggaacaaggatggccggattgggatgattcctgttccttatgttgaaaag
cttgtgagatcctcaccacatggaaagcacgggaataggaattccaacagttatgggatc
ccagaacctgctcatgcgtatgcccaacctcagaccacaactcctctacctgcagtttcc
agtactcctggggcagcaatcaaccctttgccatccacacagaatggacctgtctttgca
aaagccatccagaaaagagtaccctgtgcttatgacaagaccgccttggcattagaggtt
ggtgacattgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaagtgaat
gggcgcaaagggcttttcccctttacgcatgtcaaaatcattgaccctcaaaaccctgat
gaaaacgagtga

KEGG   Ailuropoda melanoleuca (giant panda): 100467322
Entry
100467322         CDS       T01329                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04015  Rap1 signaling pathway
aml04062  Chemokine signaling pathway
aml04510  Focal adhesion
aml04666  Fc gamma R-mediated phagocytosis
aml04722  Neurotrophin signaling pathway
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04935  Growth hormone synthesis, secretion and action
aml05100  Bacterial invasion of epithelial cells
aml05135  Yersinia infection
aml05163  Human cytomegalovirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05211  Renal cell carcinoma
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100467322 (CRK)
   04012 ErbB signaling pathway
    100467322 (CRK)
   04015 Rap1 signaling pathway
    100467322 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100467322 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100467322 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100467322 (CRK)
   04062 Chemokine signaling pathway
    100467322 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100467322 (CRK)
   04935 Growth hormone synthesis, secretion and action
    100467322 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100467322 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467322 (CRK)
   05206 MicroRNAs in cancer
    100467322 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100467322 (CRK)
   05211 Renal cell carcinoma
    100467322 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100467322 (CRK)
   05100 Bacterial invasion of epithelial cells
    100467322 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100467322 (CRK)
   05163 Human cytomegalovirus infection
    100467322 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:aml04990]
    100467322 (CRK)
Domain-containing proteins not elsewhere classified [BR:aml04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100467322 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10
Other DBs
NCBI-GeneID: 100467322
NCBI-ProteinID: XP_034495820
LinkDB
Position
13
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPSVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggttgagccgg
caggaggcggtggcgctcttgcagggccagcggcacggggtgtttctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctccgagaattcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgtctgtgccaccgtcgcccgcccagcctccgccc
ggggtgagcccctcccgactccgaataggagatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacattatttggacactacaacattgatagaaccagtttccaga
tctaggcagggtagtggagtgattctcaggcaggaggaggcagagtatgtgcgagccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcagaggacagcgaaggcaagaggggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcctgat
gaggacttcagctga

DBGET integrated database retrieval system