Ailuropoda melanoleuca (giant panda): 100466997 Help Entry 100466997         CDS       T01329                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04024   cAMP signaling pathway aml04062   Chemokine signaling pathway aml04064   NF-kappa B signaling pathway aml04210   Apoptosis aml04380   Osteoclast differentiation aml04620   Toll-like receptor signaling pathway aml04621   NOD-like receptor signaling pathway aml04622   RIG-I-like receptor signaling pathway aml04623   Cytosolic DNA-sensing pathway aml04625   C-type lectin receptor signaling pathway aml04657   IL-17 signaling pathway aml04658   Th1 and Th2 cell differentiation aml04659   Th17 cell differentiation aml04660   T cell receptor signaling pathway aml04662   B cell receptor signaling pathway aml04668   TNF signaling pathway aml04722   Neurotrophin signaling pathway aml04920   Adipocytokine signaling pathway aml04926   Relaxin signaling pathway aml04931   Insulin resistance aml04936   Alcoholic liver disease aml05132   Salmonella infection aml05134   Legionellosis aml05135   Yersinia infection aml05140   Leishmaniasis aml05142   Chagas disease aml05145   Toxoplasmosis aml05160   Hepatitis C aml05161   Hepatitis B aml05162   Measles aml05163   Human cytomegalovirus infection aml05164   Influenza A aml05166   Human T-cell leukemia virus 1 infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05168   Herpes simplex virus 1 infection aml05169   Epstein-Barr virus infection aml05170   Human immunodeficiency virus 1 infection aml05171   Coronavirus disease - COVID-19 aml05200   Pathways in cancer aml05203   Viral carcinogenesis aml05208   Chemical carcinogenesis - reactive oxygen species aml05215   Prostate cancer aml05220   Chronic myeloid leukemia aml05222   Small cell lung cancer aml05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100466997 (NFKBIA)    04668 TNF signaling pathway     100466997 (NFKBIA)    04024 cAMP signaling pathway     100466997 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100466997 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100466997 (NFKBIA)    04621 NOD-like receptor signaling pathway     100466997 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     100466997 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     100466997 (NFKBIA)    04625 C-type lectin receptor signaling pathway     100466997 (NFKBIA)    04660 T cell receptor signaling pathway     100466997 (NFKBIA)    04658 Th1 and Th2 cell differentiation     100466997 (NFKBIA)    04659 Th17 cell differentiation     100466997 (NFKBIA)    04657 IL-17 signaling pathway     100466997 (NFKBIA)    04662 B cell receptor signaling pathway     100466997 (NFKBIA)    04062 Chemokine signaling pathway     100466997 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100466997 (NFKBIA)    04926 Relaxin signaling pathway     100466997 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100466997 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     100466997 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100466997 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     100466997 (NFKBIA)    05203 Viral carcinogenesis     100466997 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100466997 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     100466997 (NFKBIA)    05215 Prostate cancer     100466997 (NFKBIA)    05222 Small cell lung cancer     100466997 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100466997 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     100466997 (NFKBIA)    05161 Hepatitis B     100466997 (NFKBIA)    05160 Hepatitis C     100466997 (NFKBIA)    05171 Coronavirus disease - COVID-19     100466997 (NFKBIA)    05164 Influenza A     100466997 (NFKBIA)    05162 Measles     100466997 (NFKBIA)    05168 Herpes simplex virus 1 infection     100466997 (NFKBIA)    05163 Human cytomegalovirus infection     100466997 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     100466997 (NFKBIA)    05169 Epstein-Barr virus infection     100466997 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100466997 (NFKBIA)    05135 Yersinia infection     100466997 (NFKBIA)    05134 Legionellosis     100466997 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100466997 (NFKBIA)    05140 Leishmaniasis     100466997 (NFKBIA)    05142 Chagas disease     100466997 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100466997 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100466997 (NFKBIA)    04931 Insulin resistance     100466997 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:aml03000]     100466997 (NFKBIA)    04131 Membrane trafficking [BR:aml04131]     100466997 (NFKBIA) Transcription factors [BR:aml03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     100466997 (NFKBIA) Membrane trafficking [BR:aml04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100466997 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  100466997 NCBI-ProteinID:  XP_002922863 Ensembl:  ENSAMEG00000015629 UniProt:  G1MAX6 LinkDB All DBs Position 20:complement(13021804..13025066) Genome browser AA seq 314 aa AA seqDB search MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEDYEQLVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQPLYSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcccgccgagcacgcccaggactgggccatggagggtccgcgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gactacgagcagttggtgaaggagctgcgggagatccgcctcgagccgcaggaggcgccg cggggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcactaaccatggaagtgatccgccaagtgaagggcgac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcaggacccagcccctctactccatcctccaggccaccaac tacaatggtcacacgtgtctacatttggcctctatccatggctacttgggcatcgtggag cttttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggtcgaacagcc ctccatcttgcagtggacctgcagaattctgacctcgtgtcactcttgttgaagtgcggg gctgatgtcaaccgagtcacctaccagggctactccccataccagctcacctggggccgc ccaagcacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagcgaggatgaggagagctacgacacggagtcagagttcacggaagacgagcta ccctatgacgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system