KEGG   Ailuropoda melanoleuca (giant panda): 100466997
Entry
100466997         CDS       T01329                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04064  NF-kappa B signaling pathway
aml04210  Apoptosis
aml04380  Osteoclast differentiation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04623  Cytosolic DNA-sensing pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04668  TNF signaling pathway
aml04722  Neurotrophin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04926  Relaxin signaling pathway
aml04931  Insulin resistance
aml05132  Salmonella infection
aml05134  Legionellosis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05215  Prostate cancer
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100466997 (NFKBIA)
   04668 TNF signaling pathway
    100466997 (NFKBIA)
   04024 cAMP signaling pathway
    100466997 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100466997 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100466997 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    100466997 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    100466997 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    100466997 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    100466997 (NFKBIA)
   04660 T cell receptor signaling pathway
    100466997 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    100466997 (NFKBIA)
   04659 Th17 cell differentiation
    100466997 (NFKBIA)
   04657 IL-17 signaling pathway
    100466997 (NFKBIA)
   04662 B cell receptor signaling pathway
    100466997 (NFKBIA)
   04062 Chemokine signaling pathway
    100466997 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100466997 (NFKBIA)
   04926 Relaxin signaling pathway
    100466997 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100466997 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100466997 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100466997 (NFKBIA)
   05203 Viral carcinogenesis
    100466997 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100466997 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100466997 (NFKBIA)
   05215 Prostate cancer
    100466997 (NFKBIA)
   05222 Small cell lung cancer
    100466997 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100466997 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100466997 (NFKBIA)
   05135 Yersinia infection
    100466997 (NFKBIA)
   05134 Legionellosis
    100466997 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100466997 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    100466997 (NFKBIA)
   05161 Hepatitis B
    100466997 (NFKBIA)
   05160 Hepatitis C
    100466997 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    100466997 (NFKBIA)
   05164 Influenza A
    100466997 (NFKBIA)
   05162 Measles
    100466997 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    100466997 (NFKBIA)
   05163 Human cytomegalovirus infection
    100466997 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100466997 (NFKBIA)
   05169 Epstein-Barr virus infection
    100466997 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100466997 (NFKBIA)
   05140 Leishmaniasis
    100466997 (NFKBIA)
   05142 Chagas disease
    100466997 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100466997 (NFKBIA)
   04131 Membrane trafficking [BR:aml04131]
    100466997 (NFKBIA)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100466997 (NFKBIA)
Membrane trafficking [BR:aml04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100466997 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 100466997
NCBI-ProteinID: XP_002922863
Ensembl: ENSAMEG00000015629
LinkDB
Position
20
AA seq 314 aa
MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEDYEQLVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQPLYSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttccagcccgccgagcacgcccaggactgggccatggagggtccgcgggacgcgctc
aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gactacgagcagttggtgaaggagctgcgggagatccgcctcgagccgcaggaggcgccg
cggggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggcactaaccatggaagtgatccgccaagtgaagggcgac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccaaccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagtgtg
ggagtcctgactcagacctgcaggacccagcccctctactccatcctccaggccaccaac
tacaatggtcacacgtgtctacatttggcctctatccatggctacttgggcatcgtggag
cttttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggtcgaacagcc
ctccatcttgcagtggacctgcagaattctgacctcgtgtcactcttgttgaagtgcggg
gctgatgtcaaccgagtcacctaccagggctactccccataccagctcacctggggccgc
ccaagcacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg
ccagagagcgaggatgaggagagctacgacacggagtcagagttcacggaagacgagcta
ccctatgacgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system