KEGG   Ailuropoda melanoleuca (giant panda): 100468274
Entry
100468274         CDS       T01329                                 

Gene name
DDB1
Definition
(RefSeq) DNA damage-binding protein 1
  KO
K10610  DNA damage-binding protein 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03420  Nucleotide excision repair
aml04120  Ubiquitin mediated proteolysis
aml05161  Hepatitis B
aml05170  Human immunodeficiency virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100468274 (DDB1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100468274 (DDB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100468274 (DDB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100468274 (DDB1)
   05161 Hepatitis B
    100468274 (DDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aml04121]
    100468274 (DDB1)
   03400 DNA repair and recombination proteins [BR:aml03400]
    100468274 (DDB1)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Adoptor protein
     100468274 (DDB1)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100468274 (DDB1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100468274 (DDB1)
SSDB
Motif
Pfam: MMS1_N CPSF_A Beta_propel IQCJ-SCHIP1
Other DBs
NCBI-GeneID: 100468274
NCBI-ProteinID: XP_002926259
Ensembl: ENSAMEG00000016518
UniProt: G1MDQ7
LinkDB
Position
16
AA seq 1140 aa
MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGK
IAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGI
IGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICF
VYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDL
RVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIV
DMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRE
TDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQGKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVAC
LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSH
YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIY
SSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEE
AEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGET
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTER
KTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
NT seq 3423 nt   +upstreamnt  +downstreamnt
atgtcgtacaactacgtggtaacggctcagaagcccaccgccgtgaacggctgcgtgacc
ggacactttacttcagctgaagacttgaacctgttgattgccaaaaacacgagattagag
atctatgtggtcactgctgaggggcttcggcccgtcaaagaggtgggcatgtatgggaag
attgcggtcatggagcttttcaggcccaagggggagagcaaggacctgctatttatcctg
acagctaaatacaatgcctgcatcctggaatataagcagagtggcgagagcattgatatc
ataacgcgagcccatggcaatgtccaggaccggattggccgcccctcagagactggcatt
attggcatcatcgaccctgagtgcaggatgattggcctgcgactctatgatggccttttc
aaggttattccactagaccgggacaataaagagctcaaggcctttaacatccgcctcgag
gagctgcatgtcatcgatgtcaagttcctatatggttgccaagcacctaccatctgcttt
gtctaccaggaccctcaggggcggcacgtgaaaacctatgaggtgtctctccgagagaag
gagttcaataagggcccttggaaacaggaaaatgtagaagctgaagcttccatggtgatt
gcagtcccagagcccttcggaggggccatcatcattggacaggaatcaatcacttatcac
aatggtgacaaatacctggcaattgcccctcctattatcaagcaaagcacgattgtctgt
cacaatcgtgtggaccccaatggctcccgctatctgctgggagacatggaaggacggctc
ttcatgctgcttttggagaaggaggaacagatggacggcaccgtcaccctcaaagatctc
cgtgtggagctccttggagagacctctattgctgaatgcttgacatacctcgataacggt
gttgtgttcgttgggtctcgccttggggactctcagcttgtgaagctcaatgttgacagc
aatgaacaaggctcctatgtagtggccatggaaacctttaccaatttaggacccattgtg
gacatgtgtgtggtggacctggagaggcaggggcagggacagctggttacttgctctggg
gcttttaaggaaggttccttgcggatcatccggaacggaattggaatccatgagcatgcc
agcattgacttaccaggcattaaaggtctgtggccgctgcggtctgaccctaaccgggag
actgatgacacactcgtgctctcttttgtgggccagacaagagttctcatgttaaatgga
gaagaggtggaagaaaccgaactgatgggtttcgtggatgatcagcagaccttcttctgt
ggcaacgtggctcatcagcaactcatccagatcacttcagcatctgtgaggttggtctct
caggaacccaaagccctggtcagcgagtggaaggagcctcagggcaagaacatcagcgtg
gcctcctgcaacagcagccaggtggtggtggcggtggggagggccctctactacctgcag
atccaccctcaggagctccggcagatcagccacacagagatggaacacgaagtggcctgc
ttggacatcaccccactgggggacagcaacgggctgtcccctctttgtgccattggcctc
tggacagacatctcagcgcgtatcctgaagctgccctcttttgagctactgcacaaagag
atgctgggtggagagatcattcctcgttccatcctgatgaccacatttgagagtagccac
tacctcctttgtgccttgggagatggggcacttttctacttcgggctcaacattgagaca
ggcctgttgagcgaccgtaaaaaggtgactctgggcacccagcccacggtattgaggact
ttccgttctctttctaccaccaacgtctttgcttgctccgaccgccccaccgtcatctac
agcagcaaccacaaattggtcttctccaatgtcaacctcaaggaagtcaactacatgtgt
cccctcaactctgatggctatcctgacagcctggccctggccaacaacagcaccctcacc
atcggcaccatcgacgagatccagaagctgcacatccgcacagttccgctctacgagtct
cccaggaagatctgctatcaggaagtgtcccagtgcttcggggtcctctccagccggatc
gaagtccaggacacaagtggcggcacaacggccctgaggcccagtgccagcacccaggcc
ctgtccagcagcgtcagctctagcaagctgttctccagcagcacagcgccacatgagacc
tcctttggggaagaggtggaggtgcacaatctcctcatcattgaccagcacaccttcgaa
gtgcttcatgcccaccagtttctgcagaatgagtatgccctcagcctggtctcctgcaag
ctgggcaaagaccccaacacgtacttcatcgtgggcacggccatggtgtatcccgaagag
gcggagcccaagcagggtcgaatcgtggtctttcagtattctgatggaaaattacagacc
gtggctgagaaggaagtgaaaggagccgtgtactctatggtggaatttaatgggaagcta
ttagccagcatcaacagcacggtgcggctctatgagtggacaacagaaaaggagctgcgc
accgagtgcaatcactacaacaacatcatggccctctacctgaagaccaagggcgacttc
atcctggtgggcgacctgatgcgctcagtgctgctgcttgcctacaagcccatggagggg
aactttgaagagatcgctcgagactttaatcctaactggatgagtgctgtggaaatcttg
gatgatgacaatttcctgggggccgaaaatgcctttaacttgtttgtgtgtcagaaggat
agtgccgccaccaccgacgaggagcggcagcacctccaggaggtgggtctcttccacctg
ggcgaattcgtcaacgtcttttgccacggctctctggtcatgcagaatctgggcgagacc
tccacccccacacagggctccgtgctcttcggcacggtcaacggcatgattgggctggtg
acctcgctgtccgagagctggtacaacctcctgttggacatgcagaatcgactcaataaa
gtcatcaagagtgtgggcaagatcgaacactccttctggagatcttttcatactgaacga
aagacagaaccagccacgggcttcatcgatggagacttgattgagagtttcctggacatc
agcaggcccaagatgcaggaggttgtggcaaacctgcagtatgatgatggcagtgggatg
aagcgagaggccacggcagacgacctcatcaaggttgtggaggagctgacgcggatccat
tag

DBGET integrated database retrieval system