KEGG   Ailuropoda melanoleuca (giant panda): 100468425
Entry
100468425         CDS       T01329                                 

Gene name
TBPL1
Definition
(RefSeq) TATA box-binding protein-like protein 1
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03022  Basal transcription factors
aml05016  Huntington disease
aml05017  Spinocerebellar ataxia
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100468425 (TBPL1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100468425 (TBPL1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100468425 (TBPL1)
   05017 Spinocerebellar ataxia
    100468425 (TBPL1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100468425 (TBPL1)
   05165 Human papillomavirus infection
    100468425 (TBPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100468425 (TBPL1)
   03021 Transcription machinery [BR:aml03021]
    100468425 (TBPL1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    100468425 (TBPL1)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     100468425 (TBPL1)
  RNA polymerase III system
    TFIIIB
     100468425 (TBPL1)
  RNA polymerase I system
    SL1/TIF-1B
     100468425 (TBPL1)
SSDB
Motif
Pfam: TBP DUF3378
Other DBs
NCBI-GeneID: 100468425
NCBI-ProteinID: XP_002922334
Ensembl: ENSAMEG00000015958
UniProt: D2HJ41
LinkDB
Position
10
AA seq 186 aa
MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATI
WSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEF
TKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFE
SRKEIL
NT seq 561 nt   +upstreamnt  +downstreamnt
atggatgcagacagtgatgttgcattggacattctaattacaaatgtagtctgtgttttt
agaacaagatgccatttgaacttaaggaagattgctttggagggagcaaatgtaatttat
aagcgtgatgttggaaaagtattaatgaagcttagaaaacctagaattacagctacaatt
tggtcctcaggaaaaattatttgcactggagcaacaagtgaagaagaagctaaatttggt
gccagacgtttagcgcgcagtctgcagaaactaggttttcaggtaatatttacagatttt
aaggtcgttaacgttttggcggtgtgtaacatgccatttgaaatccgtttgccagaattc
acaaagaacaatagacctcatgccagttacgaacctgaacttcatcctgctgtgtgctat
cggataaaatctctaagagctacattacagattttttcaacaggaagtatcacagtaaca
gggcccaacgtaaaggccgttgcgactgctgtggaacagatttacccatttgtgtttgaa
agcaggaaagaaattttataa

KEGG   Ailuropoda melanoleuca (giant panda): 100482953
Entry
100482953         CDS       T01329                                 

Gene name
TBP
Definition
(RefSeq) TATA-box-binding protein
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03022  Basal transcription factors
aml05016  Huntington disease
aml05017  Spinocerebellar ataxia
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100482953 (TBP)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100482953 (TBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100482953 (TBP)
   05017 Spinocerebellar ataxia
    100482953 (TBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100482953 (TBP)
   05165 Human papillomavirus infection
    100482953 (TBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100482953 (TBP)
   03021 Transcription machinery [BR:aml03021]
    100482953 (TBP)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    100482953 (TBP)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     100482953 (TBP)
  RNA polymerase III system
    TFIIIB
     100482953 (TBP)
  RNA polymerase I system
    SL1/TIF-1B
     100482953 (TBP)
SSDB
Motif
Pfam: TBP CDK2AP DDHD EPL1 Spt20 TFIIA DUF2722 Presenilin ABC2_membrane_2 PAT1
Other DBs
NCBI-GeneID: 100482953
NCBI-ProteinID: XP_011230619
Ensembl: ENSAMEG00000017055
UniProt: G1MFA2
LinkDB
Position
10
AA seq 324 aa
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSLLEEQQRQQQ
QQQAQQQQQQAQQQQQQQAQQQAVAAVQQSTSQQATQGASGQTPQLFHSQTLTTAPLPGT
TPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPK
RFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKI
QNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGA
KVRAEIYEAFENIYPILKGFRKTT
NT seq 975 nt   +upstreamnt  +downstreamnt
atggatcagaacaacagcctgccaccttatgctcagggcctggcctcccctcagggtgcc
atgactcctggaatccctatcttcagtccaatgatgccttatggcacaggactgactcca
cagcctatccagaacaccaacagcctttccctcttggaggagcagcaaaggcaacagcag
cagcaacaagctcagcagcagcagcaacaggcccagcagcagcagcagcagcaggcccag
cagcaggcagtggcagctgttcaacagtcaacatcccaacaggcaacacagggggcctca
ggccagacaccacagctcttccactcacagactcttaccactgctcccttgccaggcacc
actcccctgtatccctcccccatgactcccatgacccccattacccctgccacaccagct
tctgagagctcggggatcgtgccacagctgcaaaatattgtatccacagtgaatcttggc
tgtaagcttgacctaaagaccattgcacttcgtgcccgaaatgcggaatataatcccaag
cgatttgctgctgtaatcatgagaataagagagccccgaaccactgcactgatattcagt
tctgggaaaatggtgtgcacaggagccaagagcgaagaacagtccagactagcagcaagg
aaatatgccagggttgtacagaagttaggttttccagcaaagttcttggacttcaagatt
cagaacatggtggggagctgtgatgtgaagttccctataaggttagaaggccttgtgctg
acccaccagcagtttagcagttacgagccagagttgtttcctggtttaatctacagaatg
atcaagcccagaattgttcttcttatttttgtttctggaaaagttgtattaacaggtgct
aaagtccgagcagaaatttatgaagcatttgaaaatatctaccctattctaaagggtttc
aggaagacgacataa

KEGG   Ailuropoda melanoleuca (giant panda): 105242046
Entry
105242046         CDS       T01329                                 

Gene name
TBPL2
Definition
(RefSeq) TATA box-binding protein-like protein 2
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03022  Basal transcription factors
aml05016  Huntington disease
aml05017  Spinocerebellar ataxia
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    105242046 (TBPL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105242046 (TBPL2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    105242046 (TBPL2)
   05017 Spinocerebellar ataxia
    105242046 (TBPL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105242046 (TBPL2)
   05165 Human papillomavirus infection
    105242046 (TBPL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    105242046 (TBPL2)
   03021 Transcription machinery [BR:aml03021]
    105242046 (TBPL2)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    105242046 (TBPL2)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     105242046 (TBPL2)
  RNA polymerase III system
    TFIIIB
     105242046 (TBPL2)
  RNA polymerase I system
    SL1/TIF-1B
     105242046 (TBPL2)
SSDB
Motif
Pfam: TBP DUF3378 Hol_Tox
Other DBs
NCBI-GeneID: 105242046
NCBI-ProteinID: XP_034504579
LinkDB
Position
20
AA seq 445 aa
MTPIKVVGVWITLQALSVGLATDRGPRGGAGRGREPALPLPRCISPPPQARARPPRPAQP
RALAGLINGSCATCAQSGSACSSTCLGAWPFSALLKVAPPPMEEEQTYLELYLDQCVAQD
DLAPPGSPLLSPVVPDEVYIPNSSHPETVFNSHLEEVKETSGPFSSVDLSFLPDELTQEN
KDQSIIRSKHEIEENCKAQSQQSRLSLPREQDIGLGLISNSSFSNSHSHLYPGDADSVQP
SLEKPDSMPLVSIAPMTPMTPVSECSGIVPQLQNIVSTVNLACKLDLKKIALHAKNAEYN
PKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDF
KIQNMVGSCDVRFAIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLT
GAKERSEIYEAFENIYPILKGFKKA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgacgcccatcaaggtggttggggtgtggattactctacaagcactctcggttggttta
gccacggaccgtgggccgcgcggaggcgcaggccgaggccgggaacccgcgctgcccctg
ccccgctgcatctcgcccccaccgcaggctcgggcccgacccccccgccccgcacagccg
cgtgcgctcgccgggctgataaatggctcgtgtgccacgtgtgctcagtcgggctcggct
tgtagctcgacttgcctgggcgcttggcccttctcggcccttctaaaagtggcgcctcca
cccatggaggaggagcagacctacctggagctctatctggaccagtgtgtcgcccaggat
gacctcgctccgcccgggtcaccgctgctcagcccagttgtacctgatgaagtgtatata
ccgaattcatcccatccagagactgtgtttaattcacatcttgaagaagtcaaagaaaca
tctggccctttctcatctgtggatcttagcttcctaccagatgaacttacccaagaaaat
aaagaccagagtatcattagaagcaagcatgaaattgaagaaaattgtaaagctcaaagt
cagcaaagtaggttgtcattacccagagaacaggacattggtctgggcttaataagcaac
agcagtttctctaattcccattcacatctgtaccctggtgatgctgactcagtccagccc
tctcttgagaaaccagactccatgcctctggtgtccatagctcctatgacaccaatgacc
cctgtttcagaatgttctggaattgtgcctcaactacagaatatagtttccactgtaaac
ctggcctgtaaattggatctgaagaaaatagctttgcatgcaaaaaatgcagagtataac
ccaaagaggtttgctgctgtcataatgaggatccgagagcccagaacaacagccctcatc
tttagctctgggaaaatggtctgcacgggagccaaaagtgaagagcagtctcgacttgca
gcgaggaagtatgctcgtgtggtgcaaaagctgggcttcccagccagattcctcgatttt
aaaattcagaacatggttggaagctgtgatgtgagatttgccatcagactggaaggtttg
gtgctgacccatcagcagttcagtagttatgaaccagaactgtttcctggccttatctac
agaatggtaaaaccacgaattgtgttgcttatcttcgtatctggaaaagttgtgttgaca
ggtgccaaagaacgttctgagatctatgaagcatttgaaaacatctatcctattctaaag
ggttttaaaaaagcctga

DBGET integrated database retrieval system