KEGG   Ailuropoda melanoleuca (giant panda): 100468660Help
Entry
100468660         CDS       T01329                                 

Gene name
PIGT
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    100468660 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 100468660
NCBI-ProteinID: XP_002917426
Ensembl: ENSAMEG00000004281
UniProt: D2H6N2
LinkDB All DBs
Position
Un
AA seq 578 aa AA seqDB search
MAAALPLAVLLLLLLGPVGGGHAEPPRDTLREELVITPLPSGDVAATFQFRTRWDSDLQR
EEVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDKSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANGTDHSFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNTRCTSISWELRQ
TLSVVYDAFVTGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITSYHQDNETLEVSPPP
TTTYQDVTLGTLKTYAVYDLLDTAVINNSRNLNLQLKWKSPPATEAPPVPFLYAQRYVSG
YGLHNGELNTLLYNTHPYRAFPVLVLDTVPWYLRLYVHTLTITAKGKENKPSYVHYQPAQ
DRLQPHLLEMLIQLPPNSATKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSVVA
AKPVDWEESPLFKSLYPVSDSSSYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPSTGGLAKWLANLIRRARGVPPL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccttgccgcttgctgtgctcctgctgctgctcctggggccggtgggcggg
ggccatgcagagcctccacgcgacaccctgcgggaggagctcgttatcaccccgttgcct
tctggggacgtagccgccacattccagttccgcacgcgctgggattcggacctgcagcgg
gaagaagtgtctcattataggctatttcccaaagccctggggcagttgatctccaagtat
tctctacgagagctgcacttgtcattcacgcaaggcttctggaggactcgatactggggg
ccacctttcctgcaggccccatcaggtgcagaactctgggtctggttccaagacaccgtc
actgacgtggataaatcttggaaggagctcagtaatgtcctctcggggatcttctgcgct
tctctgaacttcatcgactctaccaacacggtcactcccactgcctccttcaaacccctg
gggctggccaatggcactgatcattctttcctgcgctacgctgtgctgccacgagaggtc
gtctgcacggagaaccttaccccgtggaagaagctcttgccctgtagttccaaggcaggc
ctgtctgtgctgctgaaggctgatcgcttattccacaccagctaccactcccaggcagtg
catatccgtcctgtgtgcagaaacacgcgctgtaccagcatctcctgggagctgaggcag
accctctctgtggtatatgatgccttcgtcacagggcaggggaagaaagactggtccctc
ttccggatgttctcccgaacacttacagagccctgtcccctggcttcagagagccgagtc
tatgtggacatcaccagctaccaccaggacaatgagacgttggaggtgagcccgccccca
accaccacataccaggatgtcaccctcggtaccctgaagacctacgccgtctacgacttg
cttgacacagctgtgatcaacaactcccgtaacctcaacctccagctcaagtggaagagc
cctcctgcgactgaggcccctccggtgcccttcctgtatgcccagcgatacgtgagcggc
tacgggctgcacaacggggagctgaacacgctgctgtacaacacccacccgtaccgggcc
ttccccgtgctcgtgctggacaccgtgccctggtacctgcggctctacgtgcacaccctc
accatcaccgccaagggcaaggagaacaaaccgagttacgtccactaccagcccgcgcag
gaccggctgcagccgcacctgctggagatgctgattcagctgccgcccaactcggccacc
aaggtctccattcagtttgagcgggcgctgctcaagtggaccgagtacaccccggacccc
aaccatggcttctatgtcagcccgtctgtcctcagtgcactcgtgcccagcgtggtggca
gccaagcccgtggactgggaggagagccccctcttcaagtccctgtacccggtgtccgac
agctccagctatttcgtgcgcctctacacggagccgctgctggtgaatctgcccacgccg
gacttcagcatgccctacaacgtcatctgcctcacatgcacagtggtggccgtgtgctat
ggctccttctacaatctcctcacccgaaccttccacatcgaggagcccagcaccggtggc
ctggccaagtggctggccaaccttatccggcgtgcccgtggtgtccccccgctctga

DBGET integrated database retrieval system