KEGG   Ailuropoda melanoleuca (giant panda): 100468694
Entry
100468694         CDS       T01329                                 

Gene name
EP300
Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04024  cAMP signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04310  Wnt signaling pathway
aml04330  Notch signaling pathway
aml04350  TGF-beta signaling pathway
aml04520  Adherens junction
aml04630  JAK-STAT signaling pathway
aml04720  Long-term potentiation
aml04916  Melanogenesis
aml04919  Thyroid hormone signaling pathway
aml04922  Glucagon signaling pathway
aml04935  Growth hormone synthesis, secretion and action
aml05016  Huntington disease
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05206  MicroRNAs in cancer
aml05211  Renal cell carcinoma
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100468694 (EP300)
   04330 Notch signaling pathway
    100468694 (EP300)
   04350 TGF-beta signaling pathway
    100468694 (EP300)
   04630 JAK-STAT signaling pathway
    100468694 (EP300)
   04066 HIF-1 signaling pathway
    100468694 (EP300)
   04068 FoxO signaling pathway
    100468694 (EP300)
   04024 cAMP signaling pathway
    100468694 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100468694 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100468694 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100468694 (EP300)
   04935 Growth hormone synthesis, secretion and action
    100468694 (EP300)
   04919 Thyroid hormone signaling pathway
    100468694 (EP300)
   04916 Melanogenesis
    100468694 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    100468694 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100468694 (EP300)
   05206 MicroRNAs in cancer
    100468694 (EP300)
   05203 Viral carcinogenesis
    100468694 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100468694 (EP300)
   05215 Prostate cancer
    100468694 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100468694 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100468694 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100468694 (EP300)
   05161 Hepatitis B
    100468694 (EP300)
   05164 Influenza A
    100468694 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100468694 (EP300)
   05165 Human papillomavirus infection
    100468694 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100468694 (EP300)
   03036 Chromosome and associated proteins [BR:aml03036]
    100468694 (EP300)
   03029 Mitochondrial biogenesis [BR:aml03029]
    100468694 (EP300)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100468694 (EP300)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100468694 (EP300)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100468694 (EP300)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100468694 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100468694
NCBI-ProteinID: XP_002927072
Ensembl: ENSAMEG00000013940
UniProt: G1M5Y3
LinkDB
Position
15
AA seq 2424 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQPQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSAAGMMNSPVNQPAMGMNTGMNAGMNPGMLN
AGSGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQIGAGGLGLQIQTKSVLPNNLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVASLGPMPTAAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQPGLNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTN
MPLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQSALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQTQALHPPPRQTPTPPPTQLPPQVQP
SLPAAPSADQPSQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSS
TEVNSQTIPEKQPSQEVKMEAKMEVDPPEPADAQPEDIPETKAEDCKMEPTETEERGAEL
KTETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPXTPTTPT
GQQPATPQTPQPQPPSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPP
LPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMTRGPS
GHLEPGMGPTGMQQQPQWVQGGLPQPQQLQPGMPRPAMMSVAQHGQPLNIAPQPGLGQVG
VSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYASSNP
QPLAGQPGMPQGQPGLQPPAMPGQQGVHSSPAMPNMSPMQAGVQRAGLPQQQPQQPLQPP
MGGMSPQAQQMNMNHNAMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGV
GYPPPPPPPPQPQQQRMQHHLQQMQPGSMGQMGQLPQALGAEAGAGLQAYQQRLLQQQMG
SPAQPNPMSPQQHMLPSQAQSPHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPHSSPSPR
MQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQSSMLSQLASNPGMANLHGAGA
TDLGLGPDNADLNSNLSQSTLDIH
NT seq 7275 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcttcggccagcgatggcacagattttggctctctatttgatttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccagccccaacagaacagtcctggattaggtttgataaatagc
atggttaaaagcccaatggcacaggcaggcttgacttctcccaacatggggatgggcacc
agtggaccaaatcaaggtcctacgccatctgcagcaggtatgatgaacagtccagtaaat
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttgaat
gcaggcagtggacaggggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccaggcatgggaaatgctggcaacttaatg
acagagccactgcagcaaggctctcctcagatgggaggacaaacgggattgagaggccct
cagcctcttaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagattggagccggtggccttggtctccagattcagacaaagtctgta
ctaccaaataacttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggtcaacagcaggccccacaagtccagcagccaggcctagtgactccagtg
gcccaagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccag
cagcagcttgttcttcttttacatgctcataagtgccagcgccgggagcaggctaacggg
gaagtgaggcagtgcaaccttccccactgtcgcacaatgaagaacgtcctaaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtgtgtctcccccttaaaaat
gctggagataagagaaatcagcaatcaattctgactggagcaccagttggacttggaaat
actagctccctaggtgtgggtcaacagtctacccctagcctaagcactgttagtcagatt
gatcccagctctatagaaagggcctatgcagctcttggtctgccctatcaagtaaatcag
atgccaacgcagccccaggtgcaagcaaagaaccagcagaatcagcaatctgggcagtct
ccccaaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaacgtcgaatcttctttctgactcaatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgccagtgtggcctccctgggtcctatgccaacagca
gctcaaccatccaatactggaattcggaaacaatggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaacttgttcaagccatatttcctactccggatcctgctgct
ttaaaagacagacgaatggaaaacttagttgcatatgcccggaaagtggaaggggacatg
tatgaatctgcaaataatcgagcggaatactaccacttgctagctgagaagatctataag
atccagaaagaactagaagaaaaacgaaggactagactacagaaacaaaacatgctgccc
agtgctgcaggcatggtgccagtttctatgaatccagggcccaatatggggcagccacaa
ccaggaatgacttccaatggccctctacctgacccatctatgatccgcggcagtgtgcca
aaccagatgatgcctcggataactccacagcctggtttgaatcagtttggccagatgagt
atgccccagcccccaattggaccccggcaaacctctcctcttcagcaccatggacagtta
gctcagcctggaactctcaacccgcctatgggctatgggcctcgcatgcagcagccttcc
agccagagccagttccttccccagactcagttctcaacacagggaatgaatgtaacgaat
atgcctttggctccgtctggcggtcaagcaccagtgtctcaagcacaaatgtccagttct
tcctgcccagtgaactctcctataatgcctccagggtcgcaagggagccacattcactgt
ccccctctccctcaatcagctctgcatcagaattcaccctctccggtacctagtcgcacc
cctacgcctcaccacactcccccaagcataggggcccagcagccaccagcaacagcaatt
ccagcccctgttcctacacctccagccatgccccccgggccgcagacccaggctctacat
ccacctccaaggcagacacccacaccaccaccaacgcagcttcctcctcaagttcagcct
tcacttcctgctgctccttcggctgaccagccatcgcagcagcctctctcacagcagagc
accgcagcatctgttcccaccccgacggcgccgctgctgcccccacagcctgcgactcca
ctttcccaaccagctgtaagcattgaaggtcaggtatcaaatcctccatccactagtagc
acagaagtgaattctcagaccattcctgagaagcagccgtcacaggaagtgaaaatggag
gcaaagatggaagtggatccaccagaaccagcagatgctcagccagaggatattccagag
actaaagcagaagactgtaaaatggaacctacagaaacagaagagagaggggctgaatta
aaaactgaaacaaaagaggaggaagaccagccaagtacttctgctacacagtcttctcca
gccccgggacagtcaaagaagaagattttcaaaccagaagagttacgacaggcactgatg
ccaactttggaggcactttaccgacaggatccggaatccctaccctttcgtcaacctgtg
gaccctcaactcctaggaatccctgattattttgatattgtgaagagccccatggacctt
tctaccatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggat
gacatttggcttatgttcaacaatgcctggttgtataatcggaaaacatctcgggtatac
aaatactgctccaagctgtctgaagtctttgaacaagaaattgacccagtaatgcaaagc
ctcggatattgttgtggcagaaagttggagttctctccacagacactctgttgctatggc
aaacagttatgcacaatccctcgtgatgccacttactacagttaccagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccagcctcaaactacgataaataaagaacagttttccaagagaaaaaatgacacactg
gatcctgaattatttgttgaatgtacagagtgcggaagaaagatgcatcagatctgtgtt
cttcatcatgaaattatctggccatctggatttgtttgtgatggctgcttaaagaaatct
gcacgaaccaggaaagaaaataagttttctgctaaaaggttgccatctaccaggcttggc
acctttctagagaatcgtgtaaatgactttcttaggcgacaaaatcaccctgagtccgga
gaagtcactgttcgggtagttcatgcttctgacaaaactgtggaagtgaaaccaggcatg
aaagcaaggtttgtagatagtggagagatggcagaatcctttccgtaccgaaccaaagcc
ctctttgcctttgaagagatagacggtgttgacttgtgtttctttggcatgcacgttcaa
gagtatggctctgactgccctccacccaaccagaggagagtttacatatcataccttgac
agtgttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaattctaatt
ggatatttagaatacgtcaagaaattagggtacacaacagggcatatttgggcttgtccc
ccaagtgagggagatgactatatcttccattgccatcctcctgaccagaagatacccaag
cccaagcgactgcaggagtggtacaaaaagatgcttgacaaggccgtgtctgagcgaatc
gtccatgactacaaggatatttttaaacaagcgactgaagatcgactaacaagcgcaaag
gagctgccttactttgagggcgatttctggcccaatgttctggaagagagcattaaggaa
ctggaacaggaggaggaagagcgaaagcgagaggagaacaccagcaacgagagcacagat
gtgacgaagggagacagcaaaaatgctaaaaagaaaaataataagaaaaccagcaaaaac
aagagcagcctgagtaggggcaacaagaagaagcccggcatgcccaatgtctccaacgac
ctctcccagaagctgtacgccacgatggagaagcacaaggaggtcttctttgtgatccgt
ctcatcgctggccctgccgccaactccctgcctcccatcgtcgatcccgaccccctcatc
ccctgcgatctgatggatgggcgggatgccttccttacccttgcaagggacaagcacctg
gagttctcctcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcac
acccagagccaggaccgctttgtctacacctgcaatgagtgcaagcaccacgtggagacg
cgctggcactgcactgtctgcgaggattatgatctgtgtatcacctgctataacactaaa
aaccatgaccacaaaatggagaaactaggtctgggcttagatgatgagagcaacagccag
caggccgcagccacccagagcccgggggactcgcggcgcctgagcatccagcgctgcatc
cagtccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccatcctgccag
aagatgaagcgggtggtgcagcacaccaagggctgcaagcggaaaaccaacggcggctgc
cccatctgcaagcagctcatcgccctctgctgctaccacgccaagcactgccaggagaac
aagtgcccggtgcccttctgcctcaacatcaagcagaaactccggcagcagcagctgcag
caccggctccagcaggcccagatgctccgcaggaggatggccagcatgcagcggaccggt
gtggtggggcagcagcaaggcctgccctcccccactcccnncactcccaccacgccgacg
ggccagcagccggccaccccacagacgccccagccccagcctccctctcagcctcagccc
acgcctcccaacagcatgcccccctacttgcccaggactcaggctgctggccctgtctcc
cagggtaaggcggcaggccaggtgacccctcccacacccccccagactgctcagccaccc
ctcccggggcccccgcctgccgcagtggaaatggcaatgcagattcagagggcggctgag
acgcagcgccagatggcccacgtgcaaatttttcaaaggccaatccagcaccagatgccc
cagatgactccaatggctcccatgggtatgaacccaccccctatgaccagaggtcccagt
gggcatttggagccagggatggggcccacagggatgcagcagcagccacagtgggtccaa
ggagggttgcctcagccccagcagctacagcccgggatgccgaggccagcaatgatgtca
gtggcccagcacggccagcccttgaatatagcaccccagccaggactgggccaggtaggt
gtgagccctctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggact
ctcaggtctcccagctctcccctacagcagcaacaggtgctcagtatccttcacgccaac
ccccagctgttggctgcattcatcaagcagcgggctgccaagtacgccagctcgaatccg
cagcccctcgctgggcagcccggcatgccccagggccagccggggctgcaaccacctgcc
atgccgggccagcagggcgtccactccagtccagccatgccgaacatgagccccatgcaa
gcgggcgtccagagggccggcctgccccagcagcagccgcagcagccgctccagcccccc
atgggagggatgagcccccaggctcagcaaatgaacatgaatcacaacgccatgccttcg
cagttccgagacatcttgcggcggcagcaaatgatgcagcagcagcagcagcagggagcg
gggcccgggatcggccccgggatggccaaccataaccagttccagcaaccgcaaggggtg
ggctaccccccaccgccacccccgccgccacagccgcagcagcagcgcatgcaacaccac
ctgcagcagatgcaaccggggagcatggggcagatgggccagctcccccaggccttggga
gcggaggcaggggccggcctgcaggcgtatcagcaacgactcctccagcagcagatgggg
tcccctgctcagcccaaccccatgagcccccagcagcatatgctcccaagccaggcgcag
tccccacacctccaaggccagcagatcccttcttctctctccaatcaagtgcgctctccc
cagcccgtcccttctccgcggccgcagtcccagcccccccactccagcccttccccaagg
atgcagcctcagccttcgccacaccacgtctccccgcagaccagttctccacatccggga
ctggtcgccgcccaggccaaccccatggaacaagggcattttgccagcccagaccagagc
tcgatgctctctcagctcgctagcaatccgggcatggcaaacctccacggtgcgggcgcc
acggacctggggctcggccccgataacgcggacttgaattcgaacctctcgcagagtacg
ctagacatacactag

KEGG   Ailuropoda melanoleuca (giant panda): 100480008
Entry
100480008         CDS       T01329                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04024  cAMP signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04310  Wnt signaling pathway
aml04330  Notch signaling pathway
aml04350  TGF-beta signaling pathway
aml04520  Adherens junction
aml04630  JAK-STAT signaling pathway
aml04720  Long-term potentiation
aml04916  Melanogenesis
aml04919  Thyroid hormone signaling pathway
aml04922  Glucagon signaling pathway
aml04935  Growth hormone synthesis, secretion and action
aml05016  Huntington disease
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05206  MicroRNAs in cancer
aml05211  Renal cell carcinoma
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100480008 (CREBBP)
   04330 Notch signaling pathway
    100480008 (CREBBP)
   04350 TGF-beta signaling pathway
    100480008 (CREBBP)
   04630 JAK-STAT signaling pathway
    100480008 (CREBBP)
   04066 HIF-1 signaling pathway
    100480008 (CREBBP)
   04068 FoxO signaling pathway
    100480008 (CREBBP)
   04024 cAMP signaling pathway
    100480008 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100480008 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100480008 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100480008 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    100480008 (CREBBP)
   04919 Thyroid hormone signaling pathway
    100480008 (CREBBP)
   04916 Melanogenesis
    100480008 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    100480008 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480008 (CREBBP)
   05206 MicroRNAs in cancer
    100480008 (CREBBP)
   05203 Viral carcinogenesis
    100480008 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100480008 (CREBBP)
   05215 Prostate cancer
    100480008 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100480008 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100480008 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100480008 (CREBBP)
   05161 Hepatitis B
    100480008 (CREBBP)
   05164 Influenza A
    100480008 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100480008 (CREBBP)
   05165 Human papillomavirus infection
    100480008 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100480008 (CREBBP)
   03036 Chromosome and associated proteins [BR:aml03036]
    100480008 (CREBBP)
   03029 Mitochondrial biogenesis [BR:aml03029]
    100480008 (CREBBP)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100480008 (CREBBP)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100480008 (CREBBP)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100480008 (CREBBP)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100480008 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100480008
NCBI-ProteinID: XP_034526362
Ensembl: ENSAMEG00000010799
LinkDB
Position
10
AA seq 2450 aa
MALRTACTAHLVFLQRRSSLWICLWTRAHVVGLLDFGSLFDLENDLPDELIPNGGELSLL
NSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAPGQPNSANMAS
LGAMGKSPLNQGDSAAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPG
ICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGA
TSSVLAETLTQVSPQMASHAGLNTAQAGGMTKMGMTGNTSPFGQPFSQTGGQQMGAPGVN
PQLSSKQSMVNSLPPFPTDIKNASVTNVPNMSQMQTSVGIVPTQAIAAGPTADPEKRKLI
QQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQ
IISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPATGIQNTIGSVGTGQQNAASLSNPN
PIDPSSMQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPPTHQQMRTLNPLGNNPVNIPAG
GITTDQQPPNLISESALPASLGATNPLMNDGSSPANIGTLSTIPTAAPPSSTGVRKGWHE
HVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLL
AEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPGIPQAQPVRPPNGPMPLPVNR
VQVSQGMNSFTPMSLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPN
MMGAHANNIMAQAPAQNQFLPQNQFQSSSGAMSVNSVGMGQPAAQTGVPQGQVPGAALPN
PLNMLGPQASQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTP
ASSSGQTPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTP
VHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPMLEVKAEVKTEDTEPDAS
ESKVEPGSAMMEEDLQGSSQVKEETDTTEQKVEPMEVDEKKPEVKVEAKEEEENSANGAA
SQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKN
PMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDP
VMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTL
GDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNC
LKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEV
KPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYI
SYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQ
KIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEE
SIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMP
NVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLA
RDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCIN
CYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCS
LPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLR
QQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQP
SPVSMSPAGFPNVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQH
LYRVNINNGMPPGRTGMVTPVSQMAPVGLNVPRPNQVSGPVMPNLPPGQWQQAPLPQQQP
MPGMPRPVLSMQAQPAVAGPRMSGVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILK
SNPQLMAAFIKQRTAKYVASQPGLQPQPGLQPQPGLQAQPGLHQQPGLQNLNTMQAGGPR
PGVPPQQQAMGGLNPQGQALNIMNPGHNPGMASMNPQYREMLRRQLLQQQQQQQQQQQQQ
QQQQQGSTGMAGAMAGHGQFQQPQGPGGYPPAMQQQRMQQHLPIQGSSMGQMAAQMGQLG
QMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPG
QQMATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMA
SSIDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7353 nt   +upstreamnt  +downstreamnt
atggccctccgcacagcctgcacagcccatcttgtcttcttacaaagacgctcctccctg
tggatttgcttgtggacacgtgcacacgtggttggactgctagattttggatcattgttt
gacttggaaaatgatcttcctgatgagctgatccccaatggaggagaattaagcctttta
aacagtgggaaccttgttccagatgctgcttccaaacataaacaactgtcggagctcctg
cgcggaggcagcggctccagtatcaacccaggaataggaaatgttagcgccagcagcccc
gtgcagcaaggccttggcggccaggctccagggcagccgaacagtgcaaacatggccagc
ttgggtgccatgggcaagagccctctgaaccagggagattctgcagcccccagcctgccc
aaacaggcagccagcacctctgggcccactccccctgcttcccaagcactgaatccgcaa
gcacaaaagcaagtggggctggtgaccagcagccctgccacgtcgcagacgggacctggg
atctgcatgaatgctaactttaaccagacccacccaggcctcctcaatagtaactctggc
catagtttaatgaaccaagcccagcaaggacaggcgcaagtcatgaatggatctcttggg
gccgctggcagaggaaggggagctgggatgccgtaccctgctccggccatgcagggggcc
acgagcagcgtgctggctgagacattaacacaggtttcacctcaaatggccagtcacgcc
ggactgaacacagcgcaggcaggaggcatgaccaagatgggaatgactggtaacacaagt
ccattcggacagccctttagtcaaactggagggcagcaaatgggagcccctggagtgaac
ccccagttatccagcaaacagagcatggtcaatagtttgcctcccttccctacagacatc
aagaatgcttcagtcaccaacgtgccaaacatgtctcagatgcagacttcagtgggaatt
gtccccacacaggcgatcgccgcaggccccactgcagatccggagaagcgcaaactgata
cagcagcaactggtcctcctgcttcacgctcataagtgtcagagacgagaacaagcgaac
ggagaggttcgggcctgctctctcccacattgtcgaaccatgaaaaatgttttgaatcac
atgacacattgtcaggctgggaaagcctgtcaagttgcccattgtgcatcttcacgacaa
atcatctctcattggaagaactgcacacgacatgactgtcctgtttgcctccctttgaaa
aatgccagtgacaagcgaaaccaacaaaccatcctggggtctccagctactgggattcag
aacacgattggttctgttggcacaggccagcagaatgccgcgtctctaagtaacccaaat
cccatagaccccagttccatgcagcgtgcgtacgctgcccttggactcccctacctgaac
cagccccagacacagctgcagcctcaggtccccggccagcaaccagcacagcctccaact
caccagcagatgaggaccctcaaccccctgggaaataacccagtgaacattccagcagga
ggaataacaacagatcagcagccaccaaacttgatttcagaatcagctcttccagcttcc
cttggggccacaaatccactgatgaacgatggctcaagccctgcaaacattgggaccctc
agcaccatacctacagcggccccaccttccagcaccggcgttcggaaaggctggcacgaa
catgtcactcaggacctgcggagccatctagtgcataaactcgtccaagccatctttcca
acccctgacccggcagccctgaaggatcgccgcatggagaacctggtggcctacgccaag
aaagtggagggggacatgtatgagtctgccaacagcagggatgaatactatcatttactg
gcagaaaaaatctacaagatacaaaaagaactagaagaaaaacggaggtcgcgtttgcac
aaacaaggcatcttgggtaaccagcccgccctgccggctcccggggcacagcccccaggg
attccacaggcacagcctgtgaggcctccaaacggacccatgcccctgccagtgaaccgc
gtgcaggtgtcccaagggatgaattcatttaccccaatgtccttggggaatgtacagttg
ccacaagctcccatgggaccgcgtgcagcatcccccatgaaccactctgtcccgatgaac
agcatgggctccgttcccgggatggccatttccccttcccgaatgcctcagcctccaaac
atgatgggcgctcacgccaacaacattatggcccaggcacctgcgcagaaccagttcctg
ccacagaaccagttccagtcctccagtggggcgatgagtgtgaacagtgtgggcatgggt
cagccggcggcccagacaggcgtgccacagggacaggtgcctggtgctgctcttcctaac
cctctgaacatgcttgggccccaggccagccagctgccctgcccaccagtgacacagtca
ccgttgcaccagacgccacctcctgcttccacggccgctggcatgccatctctccagcac
ccgacggcacctgggatgacccctccccagccagcagctcccacccagccatcgactccc
gcgtcgtcttccgggcagactcccaccccgactcccggctcagtgcccagtgctagccaa
acccagagcacccctacggtccaggcagcagcccaggcccaggtgaccccacagcctcag
accccagtccagcccccgtctgtggccaccccacagtcatcacagcagcagccgacacct
gtgcacgcccagcctcctggcacaccgctttcccaggcagcagccagcatcgataacagg
gtccccactccttcctcggtggccagcgccgaaaccaactcccagcagccgggacccgat
gtaccaatgctggaggtgaaggcagaggtcaagaccgaggacactgagcctgacgccagt
gaatccaaggtggagcctggatctgcgatgatggaggaggatcttcaagggtcttctcag
gttaaggaagaaacagacacaacagaacagaaagtagaaccaatggaagtggacgagaag
aaaccggaagtcaaagtagaagctaaagaggaagaagagaacagcgctaacggagctgcc
tctcagtcaacgtctccctcacagccacgcaaaaagatctttaagccggaggagttacgc
caggctctgatgccaaccctcgaagcgttgtatcgacaggatccggagtccctacctttt
cggcagcctgtagatccccagctcctaggaattccggattattttgacattgtgaagaat
cccatggacctttccaccatcaagcggaagctggatacagggcagtaccaagagccctgg
cagtatgtggacgatgtctggcttatgttcaacaatgcctggctctataatcgtaagacg
tcccgggtctataagttctgcagtaaacttgcagaggtctttgagcaagaaattgaccct
gttatgcagtcccttggatattgctgtggacgaaagtatgagttttccccacagactttg
tgctgctacgggaagcagctgtgtacaattcctcgtgacgctgcctactacagctatcag
aataggtatcatttctgtgagaagtgtttcacagagatccagggggagaatgttaccctg
ggtgacgacccttcacagccccagacgacaatttcaaaggatcagtttgaaaagaagaaa
aatgataccttagatcctgaaccttttgtcgattgcaaggagtgtggccggaagatgcat
cagatttgtgttctacactatgacatcatttggccttcaggctttgtgtgcgacaactgt
ttgaagaaaactggcagaactcggaaagaaaacaagttcagtgctaagagactacagacc
acacgattgggcaaccatttggaagaccgagtcaacaagtttttgcggcgacagaatcat
cctgaagccggggaggtctttgtccgtgtggtggccagctcagacaagactgtggaagtc
aagcctgggatgaagtcacggttcgtggattctggggaaatgtctgaatctttcccgtat
cgaaccaaagcactctttgcttttgaggaaattgacggtgtggatgtgtgcttctttggg
atgcatgtgcaggagtacggctctgactgcccccctccaaacacaaggcgtgtgtacata
tcttacctggacagtattcatttcttccggccccgatgcctccggacagctgtttaccat
gagatccttattggttatttagaatatgtgaagaaattggggtatgtaacaggacacatc
tgggcctgccccccaagtgaaggagacgactatatcttccattgccacccccctgatcag
aaaatccccaaaccaaagcgcctccaggagtggtacaagaagatgctggacaaggcgttt
gcggagcggatcattcacgactacaaggacattttcaaacaagcaactgaagacaggctc
accagtgccaaggagctgccctattttgagggtgacttctggcctaatgtgctggaggag
agcattaaggagctggagcaagaagaagaggagaggaagaaggaggagagcactgcggcc
agcgagaccacagagggcagccagggtgacagcaagaatgccaagaagaagaacaacaaa
aaaaccaacaagaataaaagcagcatcagtcgagccaacaagaagaagcccagcatgccc
aacgtgtccaacgacttgtcccagaagctctatgccaccatggagaagcacaaagaggtc
ttctttgtgatccacctgcacgctgggcctgtcatcaacacactgccccccatcgttgac
cctgaccccctgctcagctgtgacctcatggacgggcgtgacgccttcctcaccctcgcc
agagacaagcactgggagttctcctccttgcgccggtccaagtggtccacattgtgcatg
ctggtggagctgcacacccagggccaggaccgcttcgtctacacctgcaatgagtgcaag
caccatgtggagacgcgctggcactgcaccgtgtgcgaggactacgacctttgcatcaac
tgctacaacacgaagagccacgcccacaagatggtgaagtgggggctgggcctggacgac
gagggcagcagccagggcgagccgcagtccaagagcccccaggagtcacggcgcctgagc
atccagcgctgcatccagtccctggtgcacgcctgccagtgccgtaacgccaactgctcg
ctgccgtcctgccagaagatgaagcgggtggtgcagcacaccaagggctgcaagcgcaag
accaacgggggctgcccggtgtgcaagcagctcatcgccctctgctgctaccacgccaaa
cactgccaagaaaacaaatgcccggtgcccttctgcctcaacatcaaacataagctccgc
cagcagcagatccagcaccgcctgcagcaagcccagctcatgcgccggcggatggccacc
atgaacacccgcaatgtgcctcagcagagcctgccttcccctacctcagctccgcccggg
acccccacgcagcagcccagcacgccccagacaccgcagcccccagcccagccccagccc
tcgcccgtgagcatgtcaccagctggcttccccaacgtggcccggactcagccccccacc
acggtgtccaccgggaagcccaccaaccaggtgccggccccgccgccccccgcccagccc
ccaccggcagcggtggaagcagcccggcagatcgagcgggaggcccagcagcagcagcac
ctgtaccgggtgaacatcaacaatggcatgcccccggggcgcacgggcatggtgaccccg
gtgagccagatggcccccgtgggcttgaacgtgccccgtcccaaccaggtcagcgggccc
gtcatgcccaacctgccgcccgggcagtggcagcaggcgcctctgccccagcagcagccg
atgccgggcatgccccggcccgtgctgtccatgcaggcccagccggccgtggccgggccg
cggatgtccggcgtgcagccgccccggagcatctcgcctggcgccctgcaggacctgctg
cggaccctgaagtcgcccagctccccgcagcagcagcagcaggtgctcaacatcctcaag
tccaaccctcagctgatggcggccttcatcaagcagcgcacggccaagtacgtggccagt
cagcccggcctgcagccccagcccggcctgcagccccagcccggcctccaggcccagcct
ggcctgcaccagcagcccggcctgcagaacctgaacaccatgcaagccggcgggccccgg
cccggcgtgcctccgcagcagcaggcgatgggcggcctgaacccccagggccaggccctg
aacatcatgaacccgggccacaaccccggcatggcgagtatgaacccgcagtaccgggag
atgctccggaggcagctgctccagcagcagcagcaacagcaacagcagcagcagcagcag
cagcagcagcagcagggcagcacgggcatggccggggccatggccgggcacggccagttc
cagcagccccagggacccggaggctaccccccagccatgcagcagcagcggatgcagcag
cacctccccatccagggcagctccatgggccagatggcggctcagatgggacagctcggc
cagatggggcagccggggctgggcgcagacagcacccccaacatccagcaggccctgcag
cagcggattctgcagcagcagcagatgaagcagcagattgggtccccgggccagccgaac
cccatgagcccccagcagcacatgctctcaggacagccgcaggcctcgcacctccccggc
cagcagatggccacgtccctcagtagccaggtgcggtctccagcccctgtccagtctccg
cggccccagtcccagcctccacattccagcccgtcgccacggatacagccccagccttcg
ccacaccacgtctcgccccagactggttccccccacccaggactcgcagtcaccatggcc
agctccatagatcagggacacttggggaaccccgaacagagtgcaatgctcccacagctg
aacacccccaacaggagtgcgttgtccagtgagctgtccctggtcggcgacaccacagga
gacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system