KEGG   Ailuropoda melanoleuca (giant panda): 100468755
Entry
100468755         CDS       T01329                                 

Gene name
KAT2A
Definition
(RefSeq) histone acetyltransferase KAT2A isoform X1
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04330  Notch signaling pathway
aml04919  Thyroid hormone signaling pathway
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100468755 (KAT2A)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100468755 (KAT2A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100468755 (KAT2A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100468755 (KAT2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aml03021]
    100468755 (KAT2A)
   03036 Chromosome and associated proteins [BR:aml03036]
    100468755 (KAT2A)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100468755 (KAT2A)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100468755 (KAT2A)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100468755 (KAT2A)
   HAT complexes
    PCAF complex
     100468755 (KAT2A)
    STAGA complex
     100468755 (KAT2A)
    TFTC complex
     100468755 (KAT2A)
    SAGA complex
     100468755 (KAT2A)
    SLIK complex
     100468755 (KAT2A)
    ADA-HAT complex
     100468755 (KAT2A)
    HAT-A2 complex
     100468755 (KAT2A)
    ATAC complex
     100468755 (KAT2A)
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 T2SSM
Other DBs
NCBI-GeneID: 100468755
NCBI-ProteinID: XP_034496465
Ensembl: ENSAMEG00000005952
LinkDB
Position
13
AA seq 838 aa
MAEPSQASTPAPATQPRPLQSPTPAPTPTPAPSPASAPTPAPTPAPAPAPAAAPAGSTGT
GGPGVGSGGTGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHIFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPATVSAAVVPSAPIFSPTMGGGSNSSLS
LDSGGAEPMPAGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSL
LSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYI
ARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLK
EYHIKHNVLYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRI
PYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPL
GKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMT
ERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2517 nt   +upstreamnt  +downstreamnt
atggcggaaccttcccaggcctcgaccccagctccggctacgcagccccgtccccttcag
tctccaacccctgccccaactccgactcctgcccccagcccggcttcagccccgactccg
gctcccactccggcaccagcccccgccccagctgcagcgccagccggcagcacagggact
gggggtcccggggtaggaagtggggggaccgggagcggaggggatccggctcgacctggt
ctgagccagcagcagcgcgccagccagaggaaggcgcaagtccgggggctgccgcgggcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgtaagtgt
aatggatggaaaaaccccaagccccccactgcaccccgcatggacctgcagcagccagct
gccaacctgagcgagctgtgccgcagctgtgagcaccccttggctgaccacgtgtcccac
ctggagaatgtgtcagaggatgagattaaccgactgctgggtatggtggtggacgtggag
aatctctttatgtctgttcacaaagaagaggacacagacactaagcaggtctatttctat
ctcttcaagctgctgcggaaatgcatcctgcagatgacccggccggtggtggagggctcc
ctgggcagtcccccgtttgagaagcctaatattgagcagggtgtgctgaactttgtgcag
tacaagtttagtcacctggctcctcgggagcggcagacgatgtttgagctctcaaagatg
ttcctgctttgccttaactactggaagcttgagacgcctgcccaatttcggcagcggtct
caggccgaggacgtggctacctacaaggtcaattataccagatggctctgctactgccac
gtgccccagagctgtgacagcctcccccgctacgagaccactcacatctttgggcgaagc
ctcctccgctccatcttcactgtgacccggcggcagttgctggagaaattccgggtggag
aaggacaagttggtgcctgagaagaggaccctcatccttacccacttcccaaaattcctg
tccatgctggaggaggagatctatggggcaaactctccaatctgggagtccggcttcacc
atgccaccctcagaggggacccagctggtgcccaggccggctacagtcagcgcggcagtt
gtccccagtgcccccatcttcagccccaccatgggtgggggcagcaacagctccttaagc
ctggattccggaggggctgagcccatgccagcaggtgagaagaggaagctcccggagaac
ctgaccctggaggatgccaagcggctccgtgtcatgggcgacatccccatggagctggtc
aacgaggtcatgctcaccatcactgaccctgccgccatgctggggcctgagacgagcctg
ctgtcggccaacgcagcccgggacgagacggcccgcctggaggagcgccgcggcatcatc
gagttccacgtcatcggcaactcgctgacacccaaggccaaccggcgggtgctgctctgg
cttgtggggctgcagaacgtcttctcccaccagctgccgcgcatgcccaaggagtacatc
gcccgcctcgtctttgacccgaagcacaagactctggccttgatcaaggatgggcgggtc
atcggtgggatctgcttccgcatgtttcccactcagggcttcacagagattgtcttctgc
gctgtcacctcaaacgagcaggtcaagggctatggcactcacctgatgaaccacctgaag
gagtatcatatcaaacacaacgtcctgtacttcctcacctacgccgacgagtatgccatt
ggctacttcaaaaagcagggcttctccaaggacatcaaagtgcccaagagccgctacctg
ggctacattaaggactatgagggtgcaacgttgatggagtgtgagctgaatccccggatc
ccctacacggaactgtcccacatcatcaaaaagcagaaggagatcatcaagaagctgatt
gaacgcaaacaggcccagatccgaaaggtctaccctgggctcagctgcttcaaggagggt
gtgaggcagatccctgtggagagtgtccccggcattcgagagacgggctggaagccactg
gggaaggagaaggggaaggagttgaaggatccagaccagctctacacaaccctcaaaaac
ttgctggcccagatcaagtcacaccccagtgcctggcccttcatggagcctgtgaagaag
tcggaggcccctgactactacgaggtcatccgcttccctatcgacctgaagaccatgaca
gagcgactgcgcagccgttactatgtcacccgcaagctcttcgtggccgacctgcagcgg
gtcatcgccaactgccgcgagtacaaccccccggacagcgagtactgccgctgcgccagc
gccctggagaagttcttctatttcaagctcaaggagggggggctcattgacaagtag

KEGG   Ailuropoda melanoleuca (giant panda): 100482031
Entry
100482031         CDS       T01329                                 

Gene name
KAT2B
Definition
(RefSeq) histone acetyltransferase KAT2B isoform X1
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04330  Notch signaling pathway
aml04919  Thyroid hormone signaling pathway
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100482031 (KAT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100482031 (KAT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100482031 (KAT2B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100482031 (KAT2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aml03021]
    100482031 (KAT2B)
   03036 Chromosome and associated proteins [BR:aml03036]
    100482031 (KAT2B)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100482031 (KAT2B)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100482031 (KAT2B)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100482031 (KAT2B)
   HAT complexes
    PCAF complex
     100482031 (KAT2B)
    STAGA complex
     100482031 (KAT2B)
    TFTC complex
     100482031 (KAT2B)
    SAGA complex
     100482031 (KAT2B)
    SLIK complex
     100482031 (KAT2B)
    ADA-HAT complex
     100482031 (KAT2B)
    HAT-A2 complex
     100482031 (KAT2B)
    ATAC complex
     100482031 (KAT2B)
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Other DBs
NCBI-GeneID: 100482031
NCBI-ProteinID: XP_034517947
Ensembl: ENSAMEG00000000922
LinkDB
Position
6
AA seq 771 aa
MAKAPAVFQGPQDSLACRLGQLYGCAPSELTTPWTFVGATAEESCKCNGWKNPNPSPTPP
RADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDA
DTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKER
QTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRY
ETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQN
SPIWDQDFLSASSRTSQLGIQTVISPPPVAGTISYNSNSSSLEQPNGGSTSPSCKGSSGL
EANPGEKRKMNDSHAMEEAKKPRVMGDIPMELIDEVMSTITDPAAMLRPETNLLSAHSAR
DEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDP
KHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHD
ILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSV
IIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKE
PKDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRY
YVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggccaaggccccagctgtgttccagggacctcaggacagtctggcttgtcgccttggc
cagctttatggatgcgccccctcggaactgaccactccgtggacatttgttggggccacg
gccgaggagtcttgtaaatgtaatggctggaaaaatcccaacccttctcccacgcccccc
agagctgacctgcagcagatcattgtcagcctaacagaatcctgccggagctgtagccat
gccctagctgctcatgtttcccacctggaaaatgtgtccgaggaagaaatgaacagactc
ctgggaatagtgttggatgtggaatatctctttacctgcgtccacaaggaagaagatgca
gataccaaacaagtttatttctatctctttaagctcttgagaaagtctattttacaaaga
ggaaaacctgtggttgaaggctctttggagaagaaacccccatttgaaaaacctagtatt
gaacagggtgtgaataactttgtacagtacaaatttagtcacctgccatccaaagaaagg
caaacaatagttgagttggcaaaaatgttcctaaaccgcatcaactattggcatctggag
gcaccatctcaacgaagactgcgatctcccaatgatgatatttctggatacaaagagaac
tacacaaggtggctgtgttactgcaacgtgccccagttctgtgacagtctacctcggtat
gaaaccacccaggtgtttgggagaacgctgctgcgctcagtcttcacagtcatgagacga
caactcctggaacaagcgagacaggagaaagacaaactgccacttgaaaaacgaactcta
atcctcacgcatttcccaaagtttctctccatgttagaagaagaagtgtatagtcaaaac
tctcctatctgggatcaggattttctctcagcctcttccagaaccagccagctaggaatc
caaacagttatcagcccacctcctgtagctgggaccatttcatataattcaaactcatct
tcccttgagcaacctaatggagggagcaccagtccttcctgcaaaggctcttctgggctt
gaggcaaacccaggagaaaagaggaaaatgaatgactctcatgccatggaggaggccaag
aaaccccgagttatgggggatattccaatggaattaattgacgaggtcatgtctaccatc
acagaccctgcagcaatgctcagaccagagaccaatttactgtcagcacattcagcccgg
gatgaggcagcaaggctggaagagcgcaggggtgtgattgaatttcacgtggtcggcaat
tccctgaaccagaaacccaacaagaagattctaatgtggctagtcggactacagaatgtg
ttctcacaccagctgccccggatgccaaaagagtacatcacacggcttgtctttgacccg
aaacacaaaacccttgccctaattaaagatggccgtgttattggtggtatctgtttccgt
atgttcccatcccaaggattcacagagattgttttctgtgctgtaacctcaaatgagcaa
gtcaagggctatggaacacacctgatgaatcacttgaaagaatatcatataaaacatgat
atcctgaacttcctcacatatgcagatgaatatgcaattggttatttcaagaaacagggt
ttctccaaagaaattaaaatacctaaaaccaaatatgttggctacatcaaggattatgaa
ggggccactttaatgggatgtgagttaaatccacggatcccatacacagaattttctgtc
atcatcaagaagcaaaaggagatcattaaaaagctgatagaaagaaaacaagcccagatt
cgaaaagtataccctggactttcatgttttaaagatggagttcggcagattccaatagaa
agcattcctggaattagagagacaggctggaagccgagtggaaaagagaaaagtaaagag
cccaaagaccctgaccagctttacagcacactcaagagcatccttcagcaggtgaagagc
catcaaagcgcttggcccttcatggaacctgtgaagagaacagaagctccgggatattat
gaagttataaggttccccatggatctgaaaaccatgagcgaacgcctcaagaataggtac
tacgtgtctaagaaattattcatggcagacttacagcgagtctttaccaattgcaaagag
tacaacccccctgagagcgaatactacaaatgtgccaatatcctggagaaattcttcttc
agtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system