KEGG   Ailuropoda melanoleuca (giant panda): 100469030
Entry
100469030         CDS       T01329                                 

Gene name
BUB3
Definition
(RefSeq) mitotic checkpoint protein BUB3 isoform X2
  KO
K02180  cell cycle arrest protein BUB3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100469030 (BUB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100469030 (BUB3)
Spliceosome [BR:aml03041]
 Complex A
  Other components
   Complex A specific factors
    100469030 (BUB3)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     100469030 (BUB3)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 100469030
NCBI-ProteinID: XP_002927295
Ensembl: ENSAMEG00000009521
LinkDB
Position
6
AA seq 326 aa
MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVL
DCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTV
KLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAI
SFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE
MDDTEHPEDGIFIRQVTDAETKPKST
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaccggttctaacgagttcaaactgaaccagccacccgaggacggcatctcctcggtg
aagttcagccccaacacctcccagttcctgctggtctcctcctgggacacgtcggtgcgc
ctctacgatgtgccggccaactccatgcggctcaagtaccagcacaccggcgccgtcctg
gactgcgctttctacgatccaacacatgcttggagtgggggattagaccatcaattgaaa
atgcatgatttgaacactgatcaagaaaatctcgttggtacccatgatgcccctatcaga
tgtgttgaatactgtccagaagtgaatgtgatggtgacagggagttgggatcagacagtt
aaattgtgggatcccagaacgccttgtaatgcagggaccttctctcagcctgaaaaggtg
tataccctctcagtgtctggagaccggctgattgtgggcaccgcaggccgcagagtgctg
gtgtgggacttacggaacatgggctatgtgcagcagcgccgggagtccagcctcaagtac
cagactcgctgcatccgggcatttccaaataagcagggttatgtattaagctccattgaa
gggcgagtggcagttgagtacttggacccaagccctgaggtacagaagaagaagtatgcc
ttcaagtgtcacagactaaaggagaacaatattgagcagatttacccagtcaatgccatt
tcctttcacaacatccacaatacatttgctacaggtggctctgatggatttgtaaacatt
tgggatccatttaacaaaaagcgactgtgccagttccatcggtaccccaccagcattgca
tccctggccttcagtaatgacgggaccacgcttgcaatagcatcgtcgtatatgtatgag
atggatgacacggaacatcctgaagatggtatcttcattcgccaagtgacagatgcagaa
acaaaacccaagtccacctaa

DBGET integrated database retrieval system