KEGG   Ailuropoda melanoleuca (giant panda): 100469346
Entry
100469346         CDS       T01329                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04015  Rap1 signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04068  FoxO signaling pathway
aml04150  mTOR signaling pathway
aml04270  Vascular smooth muscle contraction
aml04510  Focal adhesion
aml04650  Natural killer cell mediated cytotoxicity
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04726  Serotonergic synapse
aml04730  Long-term depression
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05034  Alcoholism
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100469346 (BRAF)
   04012 ErbB signaling pathway
    100469346 (BRAF)
   04015 Rap1 signaling pathway
    100469346 (BRAF)
   04068 FoxO signaling pathway
    100469346 (BRAF)
   04024 cAMP signaling pathway
    100469346 (BRAF)
   04150 mTOR signaling pathway
    100469346 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100469346 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100469346 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100469346 (BRAF)
   04062 Chemokine signaling pathway
    100469346 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100469346 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100469346 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100469346 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100469346 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100469346 (BRAF)
   04720 Long-term potentiation
    100469346 (BRAF)
   04730 Long-term depression
    100469346 (BRAF)
   04722 Neurotrophin signaling pathway
    100469346 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100469346 (BRAF)
   05205 Proteoglycans in cancer
    100469346 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100469346 (BRAF)
   05212 Pancreatic cancer
    100469346 (BRAF)
   05225 Hepatocellular carcinoma
    100469346 (BRAF)
   05226 Gastric cancer
    100469346 (BRAF)
   05214 Glioma
    100469346 (BRAF)
   05216 Thyroid cancer
    100469346 (BRAF)
   05221 Acute myeloid leukemia
    100469346 (BRAF)
   05220 Chronic myeloid leukemia
    100469346 (BRAF)
   05218 Melanoma
    100469346 (BRAF)
   05211 Renal cell carcinoma
    100469346 (BRAF)
   05219 Bladder cancer
    100469346 (BRAF)
   05215 Prostate cancer
    100469346 (BRAF)
   05213 Endometrial cancer
    100469346 (BRAF)
   05224 Breast cancer
    100469346 (BRAF)
   05223 Non-small cell lung cancer
    100469346 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100469346 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100469346 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100469346 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100469346 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100469346 (BRAF)
   05160 Hepatitis C
    100469346 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100469346 (BRAF)
   01522 Endocrine resistance
    100469346 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100469346 (BRAF)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100469346 (BRAF)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100469346 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100469346
NCBI-ProteinID: XP_019657798
Ensembl: ENSAMEG00000015264
LinkDB
Position
1
AA seq 765 aa
MAALSGGGGGGAEQDQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTS
SSSSSLSVLPSSLSVFQNPTDISRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASIAETALTSGSSPSAPPSDSTGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggcggcggtggcgcggagcaggaccaggctctgttcaac
ggggatatggagcccgaggccggcgccggcgccgcggcctcttcggctgcggaccctgcc
attcccgaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaa
gccctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcctat
gaagaatacaccagcaagctagatgccctccaacagcgagaacaacagttattggaatcc
ctggggaatggaactgatttttctgtttctagctctgcatcaacagacaccgttacatct
tcttcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccaca
gatatatcaaggagcaatcccaagtcaccacaaaaacctatcgttagagtcttcctgccc
aataaacagaggacagtggtacctgcaagatgtggagttacagtccgagacagtctaaag
aaagctctgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaagat
ggagagaagaaaccaattggctgggacactgatatttcctggcttaccggagaggaacta
catgtagaagtgttggaaaatgttccacttaccacacacaactttgtacggaaaactttt
ttcaccttagcattttgtgacttttgtcgaaagctgcttttccagggttttcgctgtcaa
acatgtggttataagtttcaccagcgttgtagtacagaggttccactgatgtgtgttaat
tatgaccaacttgatttgctgtttgtctccaagttctttgaacaccacccaataccacag
gaggaggcctccatagcagagactgcccttacgtctggatcatccccttctgctcccccc
tccgattctactgggccccaaattctcaccagtccgtctccttcaaaatccattccaatt
ccacagcctttccgaccagcagatgaagatcatcgaaatcaatttggacaaagagaccgg
tcctcatcagctccaaatgtgcatataaacacaatagaacctgtcaatattgatgacttg
attagagaccaagggtttcgtagtgatggaggatcaaccacaggtttgtctgccacccca
cctgcctcattgcctggctcactcactaatgtgaaagcattacagaaatctccaggacct
cagcgggaaaggaaatcatcttcatcctcagaagataggaatcgaatgaaaacacttggt
agacgggattcaagtgatgattgggagattcctgatgggcagatcacagtgggacagaga
attggatccgggtcatttgggacagtctacaagggaaagtggcatggtgatgtggcagtg
aaaatgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagta
ggagtactcaggaaaactcgacatgtgaatatcctactcttcatgggctattcaacaaag
ccccaactagctattgttacccagtggtgtgagggctccagcttatatcaccatctccac
atcattgagaccaaatttgagatgatcaagcttatagatattgcacggcagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatt
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtgatccgaatgcaagataaaaacccatatagctttcagtcagatgtctatgcattt
gggattgttctatatgaattgatgaccggacagttaccttattcaaacatcaacaacagg
gatcagataatttttatggtgggacgaggatatctttctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattgatggcagagtgcctaaaaaagaaaagagat
gagaggccactctttccccaaattctcgcctctattgagctgctggcccgctcattgcca
aaaattcaccgcagtgcatcagaaccctccttgaatcgggctggcttccaaacagaggat
tttagtctatatgcttgtgcttctccaaaaacacccatccaggcagggggatatggagaa
tttgcagccttcaagtag

DBGET integrated database retrieval system