KEGG   Ailuropoda melanoleuca (giant panda): 100469787
Entry
100469787         CDS       T01329                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1 isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04340  Hedgehog signaling pathway
aml04371  Apelin signaling pathway
aml04390  Hippo signaling pathway
aml04510  Focal adhesion
aml04530  Tight junction
aml04630  JAK-STAT signaling pathway
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04921  Oxytocin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04934  Cushing syndrome
aml05160  Hepatitis C
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100469787 (CCND1)
   04340 Hedgehog signaling pathway
    100469787 (CCND1)
   04390 Hippo signaling pathway
    100469787 (CCND1)
   04371 Apelin signaling pathway
    100469787 (CCND1)
   04630 JAK-STAT signaling pathway
    100469787 (CCND1)
   04068 FoxO signaling pathway
    100469787 (CCND1)
   04151 PI3K-Akt signaling pathway
    100469787 (CCND1)
   04152 AMPK signaling pathway
    100469787 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100469787 (CCND1)
   04115 p53 signaling pathway
    100469787 (CCND1)
   04218 Cellular senescence
    100469787 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100469787 (CCND1)
   04530 Tight junction
    100469787 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100469787 (CCND1)
   04921 Oxytocin signaling pathway
    100469787 (CCND1)
   04919 Thyroid hormone signaling pathway
    100469787 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100469787 (CCND1)
   05206 MicroRNAs in cancer
    100469787 (CCND1)
   05205 Proteoglycans in cancer
    100469787 (CCND1)
   05203 Viral carcinogenesis
    100469787 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100469787 (CCND1)
   05212 Pancreatic cancer
    100469787 (CCND1)
   05225 Hepatocellular carcinoma
    100469787 (CCND1)
   05226 Gastric cancer
    100469787 (CCND1)
   05214 Glioma
    100469787 (CCND1)
   05216 Thyroid cancer
    100469787 (CCND1)
   05221 Acute myeloid leukemia
    100469787 (CCND1)
   05220 Chronic myeloid leukemia
    100469787 (CCND1)
   05218 Melanoma
    100469787 (CCND1)
   05219 Bladder cancer
    100469787 (CCND1)
   05215 Prostate cancer
    100469787 (CCND1)
   05213 Endometrial cancer
    100469787 (CCND1)
   05224 Breast cancer
    100469787 (CCND1)
   05222 Small cell lung cancer
    100469787 (CCND1)
   05223 Non-small cell lung cancer
    100469787 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100469787 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100469787 (CCND1)
   04934 Cushing syndrome
    100469787 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100469787 (CCND1)
   05162 Measles
    100469787 (CCND1)
   05160 Hepatitis C
    100469787 (CCND1)
   05163 Human cytomegalovirus infection
    100469787 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100469787 (CCND1)
   05169 Epstein-Barr virus infection
    100469787 (CCND1)
   05165 Human papillomavirus infection
    100469787 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100469787 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 100469787
NCBI-ProteinID: XP_034500890
Ensembl: ENSAMEG00000001950
LinkDB
Position
16
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEESRQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSSNSFLSYHRLTRFLSKVIKCD
ADCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEADLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccaactcttatgctgcgaagtggagaccatccgccgggcgtaccccgatgcc
aacctactcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcaccc
tccgtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctccaagatgaaggagactatccccctgacg
gccgaaaagctgtgcatctacactgacaactccatccggcctgacgagcttctgcaaatg
gagctgctcctggtgaacaaactcaagtggaacctggccgcgatgaccccgcatgatttc
attgagcacttcctctccaagatgccagtggccgaggagagcagacagatcatccggaag
catgcgcagaccttcgtcgccctctgtgccacagatgtgaagttcatttccaacccgccc
tccatggtggcagccgggagtgtggtggccgccgtgcagggcctgcacctgggaagttcc
aacagcttcctgtcctaccaccgcctcactcggttcctctccaaagtgattaagtgtgat
gcggactgtctccgggcgtgccaggagcagatcgaagccctgctggagtccagcctgcgc
caggcccagcagcagagcctggaccccaaggccgccgaggaggaggaggaggaggaggag
gccgacctggcctgcacgcccaccgacgtgcgagacgtgaacatttga

DBGET integrated database retrieval system