Ailuropoda melanoleuca (giant panda): 100470035 Help Entry 100470035         CDS       T01329                                  Symbol MAPK1 Name (RefSeq) mitogen-activated protein kinase 1   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml01521   EGFR tyrosine kinase inhibitor resistance aml01522   Endocrine resistance aml01524   Platinum drug resistance aml04010   MAPK signaling pathway aml04012   ErbB signaling pathway aml04014   Ras signaling pathway aml04015   Rap1 signaling pathway aml04022   cGMP-PKG signaling pathway aml04024   cAMP signaling pathway aml04062   Chemokine signaling pathway aml04066   HIF-1 signaling pathway aml04068   FoxO signaling pathway aml04071   Sphingolipid signaling pathway aml04072   Phospholipase D signaling pathway aml04114   Oocyte meiosis aml04140   Autophagy - animal aml04148   Efferocytosis aml04150   mTOR signaling pathway aml04151   PI3K-Akt signaling pathway aml04210   Apoptosis aml04218   Cellular senescence aml04261   Adrenergic signaling in cardiomyocytes aml04270   Vascular smooth muscle contraction aml04350   TGF-beta signaling pathway aml04360   Axon guidance aml04370   VEGF signaling pathway aml04371   Apelin signaling pathway aml04380   Osteoclast differentiation aml04510   Focal adhesion aml04520   Adherens junction aml04540   Gap junction aml04550   Signaling pathways regulating pluripotency of stem cells aml04611   Platelet activation aml04613   Neutrophil extracellular trap formation aml04620   Toll-like receptor signaling pathway aml04621   NOD-like receptor signaling pathway aml04625   C-type lectin receptor signaling pathway aml04650   Natural killer cell mediated cytotoxicity aml04657   IL-17 signaling pathway aml04658   Th1 and Th2 cell differentiation aml04659   Th17 cell differentiation aml04660   T cell receptor signaling pathway aml04662   B cell receptor signaling pathway aml04664   Fc epsilon RI signaling pathway aml04666   Fc gamma R-mediated phagocytosis aml04668   TNF signaling pathway aml04713   Circadian entrainment aml04720   Long-term potentiation aml04722   Neurotrophin signaling pathway aml04723   Retrograde endocannabinoid signaling aml04724   Glutamatergic synapse aml04725   Cholinergic synapse aml04726   Serotonergic synapse aml04730   Long-term depression aml04810   Regulation of actin cytoskeleton aml04910   Insulin signaling pathway aml04912   GnRH signaling pathway aml04914   Progesterone-mediated oocyte maturation aml04915   Estrogen signaling pathway aml04916   Melanogenesis aml04917   Prolactin signaling pathway aml04919   Thyroid hormone signaling pathway aml04921   Oxytocin signaling pathway aml04926   Relaxin signaling pathway aml04928   Parathyroid hormone synthesis, secretion and action aml04929   GnRH secretion aml04930   Type II diabetes mellitus aml04933   AGE-RAGE signaling pathway in diabetic complications aml04934   Cushing syndrome aml04935   Growth hormone synthesis, secretion and action aml04960   Aldosterone-regulated sodium reabsorption aml05010   Alzheimer disease aml05020   Prion disease aml05022   Pathways of neurodegeneration - multiple diseases aml05034   Alcoholism aml05132   Salmonella infection aml05133   Pertussis aml05135   Yersinia infection aml05140   Leishmaniasis aml05142   Chagas disease aml05145   Toxoplasmosis aml05152   Tuberculosis aml05160   Hepatitis C aml05161   Hepatitis B aml05163   Human cytomegalovirus infection aml05164   Influenza A aml05165   Human papillomavirus infection aml05166   Human T-cell leukemia virus 1 infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05170   Human immunodeficiency virus 1 infection aml05171   Coronavirus disease - COVID-19 aml05200   Pathways in cancer aml05203   Viral carcinogenesis aml05205   Proteoglycans in cancer aml05206   MicroRNAs in cancer aml05207   Chemical carcinogenesis - receptor activation aml05208   Chemical carcinogenesis - reactive oxygen species aml05210   Colorectal cancer aml05211   Renal cell carcinoma aml05212   Pancreatic cancer aml05213   Endometrial cancer aml05214   Glioma aml05215   Prostate cancer aml05216   Thyroid cancer aml05218   Melanoma aml05219   Bladder cancer aml05220   Chronic myeloid leukemia aml05221   Acute myeloid leukemia aml05223   Non-small cell lung cancer aml05224   Breast cancer aml05225   Hepatocellular carcinoma aml05226   Gastric cancer aml05230   Central carbon metabolism in cancer aml05231   Choline metabolism in cancer aml05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100470035 (MAPK1)    04012 ErbB signaling pathway     100470035 (MAPK1)    04014 Ras signaling pathway     100470035 (MAPK1)    04015 Rap1 signaling pathway     100470035 (MAPK1)    04350 TGF-beta signaling pathway     100470035 (MAPK1)    04370 VEGF signaling pathway     100470035 (MAPK1)    04371 Apelin signaling pathway     100470035 (MAPK1)    04668 TNF signaling pathway     100470035 (MAPK1)    04066 HIF-1 signaling pathway     100470035 (MAPK1)    04068 FoxO signaling pathway     100470035 (MAPK1)    04072 Phospholipase D signaling pathway     100470035 (MAPK1)    04071 Sphingolipid signaling pathway     100470035 (MAPK1)    04024 cAMP signaling pathway     100470035 (MAPK1)    04022 cGMP-PKG signaling pathway     100470035 (MAPK1)    04151 PI3K-Akt signaling pathway     100470035 (MAPK1)    04150 mTOR signaling pathway     100470035 (MAPK1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100470035 (MAPK1)    04148 Efferocytosis     100470035 (MAPK1)   09143 Cell growth and death    04114 Oocyte meiosis     100470035 (MAPK1)    04210 Apoptosis     100470035 (MAPK1)    04218 Cellular senescence     100470035 (MAPK1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100470035 (MAPK1)    04520 Adherens junction     100470035 (MAPK1)    04540 Gap junction     100470035 (MAPK1)    04550 Signaling pathways regulating pluripotency of stem cells     100470035 (MAPK1)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100470035 (MAPK1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100470035 (MAPK1)    04613 Neutrophil extracellular trap formation     100470035 (MAPK1)    04620 Toll-like receptor signaling pathway     100470035 (MAPK1)    04621 NOD-like receptor signaling pathway     100470035 (MAPK1)    04625 C-type lectin receptor signaling pathway     100470035 (MAPK1)    04650 Natural killer cell mediated cytotoxicity     100470035 (MAPK1)    04660 T cell receptor signaling pathway     100470035 (MAPK1)    04658 Th1 and Th2 cell differentiation     100470035 (MAPK1)    04659 Th17 cell differentiation     100470035 (MAPK1)    04657 IL-17 signaling pathway     100470035 (MAPK1)    04662 B cell receptor signaling pathway     100470035 (MAPK1)    04664 Fc epsilon RI signaling pathway     100470035 (MAPK1)    04666 Fc gamma R-mediated phagocytosis     100470035 (MAPK1)    04062 Chemokine signaling pathway     100470035 (MAPK1)   09152 Endocrine system    04910 Insulin signaling pathway     100470035 (MAPK1)    04929 GnRH secretion     100470035 (MAPK1)    04912 GnRH signaling pathway     100470035 (MAPK1)    04915 Estrogen signaling pathway     100470035 (MAPK1)    04914 Progesterone-mediated oocyte maturation     100470035 (MAPK1)    04917 Prolactin signaling pathway     100470035 (MAPK1)    04921 Oxytocin signaling pathway     100470035 (MAPK1)    04926 Relaxin signaling pathway     100470035 (MAPK1)    04935 Growth hormone synthesis, secretion and action     100470035 (MAPK1)    04919 Thyroid hormone signaling pathway     100470035 (MAPK1)    04928 Parathyroid hormone synthesis, secretion and action     100470035 (MAPK1)    04916 Melanogenesis     100470035 (MAPK1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100470035 (MAPK1)    04270 Vascular smooth muscle contraction     100470035 (MAPK1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100470035 (MAPK1)   09156 Nervous system    04724 Glutamatergic synapse     100470035 (MAPK1)    04725 Cholinergic synapse     100470035 (MAPK1)    04726 Serotonergic synapse     100470035 (MAPK1)    04720 Long-term potentiation     100470035 (MAPK1)    04730 Long-term depression     100470035 (MAPK1)    04723 Retrograde endocannabinoid signaling     100470035 (MAPK1)    04722 Neurotrophin signaling pathway     100470035 (MAPK1)   09158 Development and regeneration    04360 Axon guidance     100470035 (MAPK1)    04380 Osteoclast differentiation     100470035 (MAPK1)   09159 Environmental adaptation    04713 Circadian entrainment     100470035 (MAPK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100470035 (MAPK1)    05206 MicroRNAs in cancer     100470035 (MAPK1)    05205 Proteoglycans in cancer     100470035 (MAPK1)    05207 Chemical carcinogenesis - receptor activation     100470035 (MAPK1)    05208 Chemical carcinogenesis - reactive oxygen species     100470035 (MAPK1)    05203 Viral carcinogenesis     100470035 (MAPK1)    05230 Central carbon metabolism in cancer     100470035 (MAPK1)    05231 Choline metabolism in cancer     100470035 (MAPK1)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100470035 (MAPK1)   09162 Cancer: specific types    05210 Colorectal cancer     100470035 (MAPK1)    05212 Pancreatic cancer     100470035 (MAPK1)    05225 Hepatocellular carcinoma     100470035 (MAPK1)    05226 Gastric cancer     100470035 (MAPK1)    05214 Glioma     100470035 (MAPK1)    05216 Thyroid cancer     100470035 (MAPK1)    05221 Acute myeloid leukemia     100470035 (MAPK1)    05220 Chronic myeloid leukemia     100470035 (MAPK1)    05218 Melanoma     100470035 (MAPK1)    05211 Renal cell carcinoma     100470035 (MAPK1)    05219 Bladder cancer     100470035 (MAPK1)    05215 Prostate cancer     100470035 (MAPK1)    05213 Endometrial cancer     100470035 (MAPK1)    05224 Breast cancer     100470035 (MAPK1)    05223 Non-small cell lung cancer     100470035 (MAPK1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100470035 (MAPK1)    05170 Human immunodeficiency virus 1 infection     100470035 (MAPK1)    05161 Hepatitis B     100470035 (MAPK1)    05160 Hepatitis C     100470035 (MAPK1)    05171 Coronavirus disease - COVID-19     100470035 (MAPK1)    05164 Influenza A     100470035 (MAPK1)    05163 Human cytomegalovirus infection     100470035 (MAPK1)    05167 Kaposi sarcoma-associated herpesvirus infection     100470035 (MAPK1)    05165 Human papillomavirus infection     100470035 (MAPK1)   09171 Infectious disease: bacterial    05132 Salmonella infection     100470035 (MAPK1)    05135 Yersinia infection     100470035 (MAPK1)    05133 Pertussis     100470035 (MAPK1)    05152 Tuberculosis     100470035 (MAPK1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100470035 (MAPK1)    05140 Leishmaniasis     100470035 (MAPK1)    05142 Chagas disease     100470035 (MAPK1)   09164 Neurodegenerative disease    05010 Alzheimer disease     100470035 (MAPK1)    05020 Prion disease     100470035 (MAPK1)    05022 Pathways of neurodegeneration - multiple diseases     100470035 (MAPK1)   09165 Substance dependence    05034 Alcoholism     100470035 (MAPK1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100470035 (MAPK1)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100470035 (MAPK1)    04933 AGE-RAGE signaling pathway in diabetic complications     100470035 (MAPK1)    04934 Cushing syndrome     100470035 (MAPK1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100470035 (MAPK1)    01524 Platinum drug resistance     100470035 (MAPK1)    01522 Endocrine resistance     100470035 (MAPK1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:aml01001]     100470035 (MAPK1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     100470035 (MAPK1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100470035 (MAPK1) Enzymes [BR:aml01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100470035 (MAPK1) Protein kinases [BR:aml01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100470035 (MAPK1) Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      100470035 (MAPK1) Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100470035 (MAPK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo Motif Other DBs NCBI-GeneID:  100470035 NCBI-ProteinID:  XP_034498670 Ensembl:  ENSAMEG00000008869 LinkDB All DBs Position 14:complement(44755983..44864040) Genome browser AA seq 348 aa AA seqDB search MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREI KILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQ ILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRW YRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDL NCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPY LEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt atggtccgcgggcaggtgttcgacgtggggccgcgctacaccaacctctcgtacatcggc gagggcgcctacggcatggtgtgctctgcttatgataatgtcaacaaagttcgagtagct atcaagaaaatcagtccttttgagcaccagacctactgccagagaactctgagggagata aaaatcttactgcgcttcagacatgagaacatcattggaatcaatgatattattcgagca ccaaccatcgagcaaatgaaagatgtatatatagtacaggacctcatggaaacagatcta tacaagctcttgaagacgcaacacctcagcaacgaccatatctgctattttctttaccag atcctcagagggttaaaatatatccattcagccaatgtactgcaccgtgacctcaaacct tccaacctgctgctcaataccacctgcgatctcaagatctgtgactttggcttggcccgt gttgcagatccggaccacgatcacacagggttcctgacggagtatgtagccacacgctgg tacagggctccggaaattatgttgaattccaagggctataccaagtccattgatatttgg tctgtaggctgcattctggcagagatgctgtccaacaggcccatcttcccggggaagcat tatctcgaccagctgaaccacattctgggtattcttggatccccatcacaggaagacctg aactgtataataaatttaaaagctagaaactacttgctttctcttccacacaaaaataag gtgccatggaacaggctgttcccaaatgctgactccaaagctctggatttactggacaag atgttgacattcaaccctcacaagaggattgaagtagagcaggctctggcccatccatat ctggagcagtattacgacccaagcgatgagcccatcgctgaggcgccattcaagtttgac atggagctggatgacctgcccaaggaaaagctcaaagaactcatcttcgaagagacagct agattccagccgggatacagatcttaa

Ailuropoda melanoleuca (giant panda): 100472388 Help Entry 100472388         CDS       T01329                                  Symbol MAPK3 Name (RefSeq) mitogen-activated protein kinase 3   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml01521   EGFR tyrosine kinase inhibitor resistance aml01522   Endocrine resistance aml01524   Platinum drug resistance aml04010   MAPK signaling pathway aml04012   ErbB signaling pathway aml04014   Ras signaling pathway aml04015   Rap1 signaling pathway aml04022   cGMP-PKG signaling pathway aml04024   cAMP signaling pathway aml04062   Chemokine signaling pathway aml04066   HIF-1 signaling pathway aml04068   FoxO signaling pathway aml04071   Sphingolipid signaling pathway aml04072   Phospholipase D signaling pathway aml04114   Oocyte meiosis aml04140   Autophagy - animal aml04148   Efferocytosis aml04150   mTOR signaling pathway aml04151   PI3K-Akt signaling pathway aml04210   Apoptosis aml04218   Cellular senescence aml04261   Adrenergic signaling in cardiomyocytes aml04270   Vascular smooth muscle contraction aml04350   TGF-beta signaling pathway aml04360   Axon guidance aml04370   VEGF signaling pathway aml04371   Apelin signaling pathway aml04380   Osteoclast differentiation aml04510   Focal adhesion aml04520   Adherens junction aml04540   Gap junction aml04550   Signaling pathways regulating pluripotency of stem cells aml04611   Platelet activation aml04613   Neutrophil extracellular trap formation aml04620   Toll-like receptor signaling pathway aml04621   NOD-like receptor signaling pathway aml04625   C-type lectin receptor signaling pathway aml04650   Natural killer cell mediated cytotoxicity aml04657   IL-17 signaling pathway aml04658   Th1 and Th2 cell differentiation aml04659   Th17 cell differentiation aml04660   T cell receptor signaling pathway aml04662   B cell receptor signaling pathway aml04664   Fc epsilon RI signaling pathway aml04666   Fc gamma R-mediated phagocytosis aml04668   TNF signaling pathway aml04713   Circadian entrainment aml04720   Long-term potentiation aml04722   Neurotrophin signaling pathway aml04723   Retrograde endocannabinoid signaling aml04724   Glutamatergic synapse aml04725   Cholinergic synapse aml04726   Serotonergic synapse aml04730   Long-term depression aml04810   Regulation of actin cytoskeleton aml04910   Insulin signaling pathway aml04912   GnRH signaling pathway aml04914   Progesterone-mediated oocyte maturation aml04915   Estrogen signaling pathway aml04916   Melanogenesis aml04917   Prolactin signaling pathway aml04919   Thyroid hormone signaling pathway aml04921   Oxytocin signaling pathway aml04926   Relaxin signaling pathway aml04928   Parathyroid hormone synthesis, secretion and action aml04929   GnRH secretion aml04930   Type II diabetes mellitus aml04933   AGE-RAGE signaling pathway in diabetic complications aml04934   Cushing syndrome aml04935   Growth hormone synthesis, secretion and action aml04960   Aldosterone-regulated sodium reabsorption aml05010   Alzheimer disease aml05020   Prion disease aml05022   Pathways of neurodegeneration - multiple diseases aml05034   Alcoholism aml05132   Salmonella infection aml05133   Pertussis aml05135   Yersinia infection aml05140   Leishmaniasis aml05142   Chagas disease aml05145   Toxoplasmosis aml05152   Tuberculosis aml05160   Hepatitis C aml05161   Hepatitis B aml05163   Human cytomegalovirus infection aml05164   Influenza A aml05165   Human papillomavirus infection aml05166   Human T-cell leukemia virus 1 infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05170   Human immunodeficiency virus 1 infection aml05171   Coronavirus disease - COVID-19 aml05200   Pathways in cancer aml05203   Viral carcinogenesis aml05205   Proteoglycans in cancer aml05206   MicroRNAs in cancer aml05207   Chemical carcinogenesis - receptor activation aml05208   Chemical carcinogenesis - reactive oxygen species aml05210   Colorectal cancer aml05211   Renal cell carcinoma aml05212   Pancreatic cancer aml05213   Endometrial cancer aml05214   Glioma aml05215   Prostate cancer aml05216   Thyroid cancer aml05218   Melanoma aml05219   Bladder cancer aml05220   Chronic myeloid leukemia aml05221   Acute myeloid leukemia aml05223   Non-small cell lung cancer aml05224   Breast cancer aml05225   Hepatocellular carcinoma aml05226   Gastric cancer aml05230   Central carbon metabolism in cancer aml05231   Choline metabolism in cancer aml05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100472388 (MAPK3)    04012 ErbB signaling pathway     100472388 (MAPK3)    04014 Ras signaling pathway     100472388 (MAPK3)    04015 Rap1 signaling pathway     100472388 (MAPK3)    04350 TGF-beta signaling pathway     100472388 (MAPK3)    04370 VEGF signaling pathway     100472388 (MAPK3)    04371 Apelin signaling pathway     100472388 (MAPK3)    04668 TNF signaling pathway     100472388 (MAPK3)    04066 HIF-1 signaling pathway     100472388 (MAPK3)    04068 FoxO signaling pathway     100472388 (MAPK3)    04072 Phospholipase D signaling pathway     100472388 (MAPK3)    04071 Sphingolipid signaling pathway     100472388 (MAPK3)    04024 cAMP signaling pathway     100472388 (MAPK3)    04022 cGMP-PKG signaling pathway     100472388 (MAPK3)    04151 PI3K-Akt signaling pathway     100472388 (MAPK3)    04150 mTOR signaling pathway     100472388 (MAPK3)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100472388 (MAPK3)    04148 Efferocytosis     100472388 (MAPK3)   09143 Cell growth and death    04114 Oocyte meiosis     100472388 (MAPK3)    04210 Apoptosis     100472388 (MAPK3)    04218 Cellular senescence     100472388 (MAPK3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100472388 (MAPK3)    04520 Adherens junction     100472388 (MAPK3)    04540 Gap junction     100472388 (MAPK3)    04550 Signaling pathways regulating pluripotency of stem cells     100472388 (MAPK3)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100472388 (MAPK3)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100472388 (MAPK3)    04613 Neutrophil extracellular trap formation     100472388 (MAPK3)    04620 Toll-like receptor signaling pathway     100472388 (MAPK3)    04621 NOD-like receptor signaling pathway     100472388 (MAPK3)    04625 C-type lectin receptor signaling pathway     100472388 (MAPK3)    04650 Natural killer cell mediated cytotoxicity     100472388 (MAPK3)    04660 T cell receptor signaling pathway     100472388 (MAPK3)    04658 Th1 and Th2 cell differentiation     100472388 (MAPK3)    04659 Th17 cell differentiation     100472388 (MAPK3)    04657 IL-17 signaling pathway     100472388 (MAPK3)    04662 B cell receptor signaling pathway     100472388 (MAPK3)    04664 Fc epsilon RI signaling pathway     100472388 (MAPK3)    04666 Fc gamma R-mediated phagocytosis     100472388 (MAPK3)    04062 Chemokine signaling pathway     100472388 (MAPK3)   09152 Endocrine system    04910 Insulin signaling pathway     100472388 (MAPK3)    04929 GnRH secretion     100472388 (MAPK3)    04912 GnRH signaling pathway     100472388 (MAPK3)    04915 Estrogen signaling pathway     100472388 (MAPK3)    04914 Progesterone-mediated oocyte maturation     100472388 (MAPK3)    04917 Prolactin signaling pathway     100472388 (MAPK3)    04921 Oxytocin signaling pathway     100472388 (MAPK3)    04926 Relaxin signaling pathway     100472388 (MAPK3)    04935 Growth hormone synthesis, secretion and action     100472388 (MAPK3)    04919 Thyroid hormone signaling pathway     100472388 (MAPK3)    04928 Parathyroid hormone synthesis, secretion and action     100472388 (MAPK3)    04916 Melanogenesis     100472388 (MAPK3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100472388 (MAPK3)    04270 Vascular smooth muscle contraction     100472388 (MAPK3)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100472388 (MAPK3)   09156 Nervous system    04724 Glutamatergic synapse     100472388 (MAPK3)    04725 Cholinergic synapse     100472388 (MAPK3)    04726 Serotonergic synapse     100472388 (MAPK3)    04720 Long-term potentiation     100472388 (MAPK3)    04730 Long-term depression     100472388 (MAPK3)    04723 Retrograde endocannabinoid signaling     100472388 (MAPK3)    04722 Neurotrophin signaling pathway     100472388 (MAPK3)   09158 Development and regeneration    04360 Axon guidance     100472388 (MAPK3)    04380 Osteoclast differentiation     100472388 (MAPK3)   09159 Environmental adaptation    04713 Circadian entrainment     100472388 (MAPK3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100472388 (MAPK3)    05206 MicroRNAs in cancer     100472388 (MAPK3)    05205 Proteoglycans in cancer     100472388 (MAPK3)    05207 Chemical carcinogenesis - receptor activation     100472388 (MAPK3)    05208 Chemical carcinogenesis - reactive oxygen species     100472388 (MAPK3)    05203 Viral carcinogenesis     100472388 (MAPK3)    05230 Central carbon metabolism in cancer     100472388 (MAPK3)    05231 Choline metabolism in cancer     100472388 (MAPK3)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100472388 (MAPK3)   09162 Cancer: specific types    05210 Colorectal cancer     100472388 (MAPK3)    05212 Pancreatic cancer     100472388 (MAPK3)    05225 Hepatocellular carcinoma     100472388 (MAPK3)    05226 Gastric cancer     100472388 (MAPK3)    05214 Glioma     100472388 (MAPK3)    05216 Thyroid cancer     100472388 (MAPK3)    05221 Acute myeloid leukemia     100472388 (MAPK3)    05220 Chronic myeloid leukemia     100472388 (MAPK3)    05218 Melanoma     100472388 (MAPK3)    05211 Renal cell carcinoma     100472388 (MAPK3)    05219 Bladder cancer     100472388 (MAPK3)    05215 Prostate cancer     100472388 (MAPK3)    05213 Endometrial cancer     100472388 (MAPK3)    05224 Breast cancer     100472388 (MAPK3)    05223 Non-small cell lung cancer     100472388 (MAPK3)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100472388 (MAPK3)    05170 Human immunodeficiency virus 1 infection     100472388 (MAPK3)    05161 Hepatitis B     100472388 (MAPK3)    05160 Hepatitis C     100472388 (MAPK3)    05171 Coronavirus disease - COVID-19     100472388 (MAPK3)    05164 Influenza A     100472388 (MAPK3)    05163 Human cytomegalovirus infection     100472388 (MAPK3)    05167 Kaposi sarcoma-associated herpesvirus infection     100472388 (MAPK3)    05165 Human papillomavirus infection     100472388 (MAPK3)   09171 Infectious disease: bacterial    05132 Salmonella infection     100472388 (MAPK3)    05135 Yersinia infection     100472388 (MAPK3)    05133 Pertussis     100472388 (MAPK3)    05152 Tuberculosis     100472388 (MAPK3)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100472388 (MAPK3)    05140 Leishmaniasis     100472388 (MAPK3)    05142 Chagas disease     100472388 (MAPK3)   09164 Neurodegenerative disease    05010 Alzheimer disease     100472388 (MAPK3)    05020 Prion disease     100472388 (MAPK3)    05022 Pathways of neurodegeneration - multiple diseases     100472388 (MAPK3)   09165 Substance dependence    05034 Alcoholism     100472388 (MAPK3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100472388 (MAPK3)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100472388 (MAPK3)    04933 AGE-RAGE signaling pathway in diabetic complications     100472388 (MAPK3)    04934 Cushing syndrome     100472388 (MAPK3)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100472388 (MAPK3)    01524 Platinum drug resistance     100472388 (MAPK3)    01522 Endocrine resistance     100472388 (MAPK3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:aml01001]     100472388 (MAPK3)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     100472388 (MAPK3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100472388 (MAPK3) Enzymes [BR:aml01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100472388 (MAPK3) Protein kinases [BR:aml01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100472388 (MAPK3) Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      100472388 (MAPK3) Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100472388 (MAPK3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo Motif Other DBs NCBI-GeneID:  100472388 NCBI-ProteinID:  XP_034526049 Ensembl:  ENSAMEG00000015300 LinkDB All DBs Position 10:complement(16747887..16754324) Genome browser AA seq 325 aa AA seqDB search MVSSAYDHVRKIRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEA MRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLI NTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAK LFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDD LPKERLKELIFQETARFQPGALEAP NT seq 978 nt NT seq  +upstreamnt  +downstreamnt atggtcagctcagcttacgaccacgtgcgcaagattcgcgtggccatcaagaaaatcagc cccttcgagcatcagacctactgccagcgcacactgcgggagatccagatcttgctgcgc ttccgccacgagaacgtcattggcattcgggacattctgcgggcgcccaccctggaagcc atgagagatgtctacattgtgcaggacctgatggagacagacctgtacaagttgctcaaa agccagcagctgagcaacgaccatgtttgctacttcctctaccagatcctgcggggcctc aagtatatccactcagccaacgtgctccaccgggatctaaagccctccaacctgcttatc aacaccacctgcgaccttaagatctgcgattttggcctggcccggattgcggaccctgag catgaccacaccggcttcctgacagaatatgtggccacacgctggtaccgggctccagaa atcatgcttaactctaagggctacaccaagtccatcgacatctggtctgtgggctgcatt ctggctgagatgctctccaaccggcccatcttccctggcaagcactacctggaccagctc aaccacattctgggtatcctcggctccccatcccaggaggacttgaattgtatcatcaat atgaaggcccgaaactacctgcagtctctgccctccaagaccaaggtggcctgggccaag ctttttcccaagtcggactcaaaagcccttgacctgctagaccggatgttgacctttaac cccaacaaacggatcacagtggaagaagcactggctcacccctacttggagcagtactac gacccaacagatgagccagtggccgaggagcctttcacctttgacatggagctggatgat ctacccaaggagcggctgaaggagctcatcttccaggagacagcccgcttccagcctggg gcgctggaggccccctaa

DBGET integrated database retrieval system