KEGG   Ailuropoda melanoleuca (giant panda): 100470035
Entry
100470035         CDS       T01329                                 

Gene name
MAPK1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04218  Cellular senescence
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04350  TGF-beta signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04371  Apelin signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04520  Adherens junction
aml04540  Gap junction
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04726  Serotonergic synapse
aml04730  Long-term depression
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04921  Oxytocin signaling pathway
aml04926  Relaxin signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml04929  GnRH secretion
aml04930  Type II diabetes mellitus
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml05010  Alzheimer disease
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05034  Alcoholism
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100470035 (MAPK1)
   04012 ErbB signaling pathway
    100470035 (MAPK1)
   04014 Ras signaling pathway
    100470035 (MAPK1)
   04015 Rap1 signaling pathway
    100470035 (MAPK1)
   04350 TGF-beta signaling pathway
    100470035 (MAPK1)
   04370 VEGF signaling pathway
    100470035 (MAPK1)
   04371 Apelin signaling pathway
    100470035 (MAPK1)
   04668 TNF signaling pathway
    100470035 (MAPK1)
   04066 HIF-1 signaling pathway
    100470035 (MAPK1)
   04068 FoxO signaling pathway
    100470035 (MAPK1)
   04072 Phospholipase D signaling pathway
    100470035 (MAPK1)
   04071 Sphingolipid signaling pathway
    100470035 (MAPK1)
   04024 cAMP signaling pathway
    100470035 (MAPK1)
   04022 cGMP-PKG signaling pathway
    100470035 (MAPK1)
   04151 PI3K-Akt signaling pathway
    100470035 (MAPK1)
   04150 mTOR signaling pathway
    100470035 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100470035 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100470035 (MAPK1)
   04210 Apoptosis
    100470035 (MAPK1)
   04218 Cellular senescence
    100470035 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100470035 (MAPK1)
   04520 Adherens junction
    100470035 (MAPK1)
   04540 Gap junction
    100470035 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100470035 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100470035 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100470035 (MAPK1)
   04620 Toll-like receptor signaling pathway
    100470035 (MAPK1)
   04621 NOD-like receptor signaling pathway
    100470035 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    100470035 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    100470035 (MAPK1)
   04660 T cell receptor signaling pathway
    100470035 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    100470035 (MAPK1)
   04659 Th17 cell differentiation
    100470035 (MAPK1)
   04657 IL-17 signaling pathway
    100470035 (MAPK1)
   04662 B cell receptor signaling pathway
    100470035 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    100470035 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    100470035 (MAPK1)
   04062 Chemokine signaling pathway
    100470035 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100470035 (MAPK1)
   04929 GnRH secretion
    100470035 (MAPK1)
   04912 GnRH signaling pathway
    100470035 (MAPK1)
   04915 Estrogen signaling pathway
    100470035 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    100470035 (MAPK1)
   04917 Prolactin signaling pathway
    100470035 (MAPK1)
   04921 Oxytocin signaling pathway
    100470035 (MAPK1)
   04926 Relaxin signaling pathway
    100470035 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    100470035 (MAPK1)
   04919 Thyroid hormone signaling pathway
    100470035 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    100470035 (MAPK1)
   04916 Melanogenesis
    100470035 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100470035 (MAPK1)
   04270 Vascular smooth muscle contraction
    100470035 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100470035 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100470035 (MAPK1)
   04725 Cholinergic synapse
    100470035 (MAPK1)
   04726 Serotonergic synapse
    100470035 (MAPK1)
   04720 Long-term potentiation
    100470035 (MAPK1)
   04730 Long-term depression
    100470035 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    100470035 (MAPK1)
   04722 Neurotrophin signaling pathway
    100470035 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    100470035 (MAPK1)
   04380 Osteoclast differentiation
    100470035 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100470035 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100470035 (MAPK1)
   05206 MicroRNAs in cancer
    100470035 (MAPK1)
   05205 Proteoglycans in cancer
    100470035 (MAPK1)
   05203 Viral carcinogenesis
    100470035 (MAPK1)
   05230 Central carbon metabolism in cancer
    100470035 (MAPK1)
   05231 Choline metabolism in cancer
    100470035 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100470035 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100470035 (MAPK1)
   05212 Pancreatic cancer
    100470035 (MAPK1)
   05225 Hepatocellular carcinoma
    100470035 (MAPK1)
   05226 Gastric cancer
    100470035 (MAPK1)
   05214 Glioma
    100470035 (MAPK1)
   05216 Thyroid cancer
    100470035 (MAPK1)
   05221 Acute myeloid leukemia
    100470035 (MAPK1)
   05220 Chronic myeloid leukemia
    100470035 (MAPK1)
   05218 Melanoma
    100470035 (MAPK1)
   05211 Renal cell carcinoma
    100470035 (MAPK1)
   05219 Bladder cancer
    100470035 (MAPK1)
   05215 Prostate cancer
    100470035 (MAPK1)
   05213 Endometrial cancer
    100470035 (MAPK1)
   05224 Breast cancer
    100470035 (MAPK1)
   05223 Non-small cell lung cancer
    100470035 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100470035 (MAPK1)
   05020 Prion disease
    100470035 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    100470035 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    100470035 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100470035 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100470035 (MAPK1)
   04934 Cushing syndrome
    100470035 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100470035 (MAPK1)
   05135 Yersinia infection
    100470035 (MAPK1)
   05133 Pertussis
    100470035 (MAPK1)
   05152 Tuberculosis
    100470035 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100470035 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    100470035 (MAPK1)
   05161 Hepatitis B
    100470035 (MAPK1)
   05160 Hepatitis C
    100470035 (MAPK1)
   05171 Coronavirus disease - COVID-19
    100470035 (MAPK1)
   05164 Influenza A
    100470035 (MAPK1)
   05163 Human cytomegalovirus infection
    100470035 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100470035 (MAPK1)
   05165 Human papillomavirus infection
    100470035 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100470035 (MAPK1)
   05140 Leishmaniasis
    100470035 (MAPK1)
   05142 Chagas disease
    100470035 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100470035 (MAPK1)
   01524 Platinum drug resistance
    100470035 (MAPK1)
   01522 Endocrine resistance
    100470035 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100470035 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100470035 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100470035 (MAPK1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100470035 (MAPK1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100470035 (MAPK1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100470035 (MAPK1)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100470035 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 100470035
NCBI-ProteinID: XP_034498670
LinkDB
Position
14
AA seq 348 aa
MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREI
KILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQ
ILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRW
YRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDL
NCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPY
LEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggtccgcgggcaggtgttcgacgtggggccgcgctacaccaacctctcgtacatcggc
gagggcgcctacggcatggtgtgctctgcttatgataatgtcaacaaagttcgagtagct
atcaagaaaatcagtccttttgagcaccagacctactgccagagaactctgagggagata
aaaatcttactgcgcttcagacatgagaacatcattggaatcaatgatattattcgagca
ccaaccatcgagcaaatgaaagatgtatatatagtacaggacctcatggaaacagatcta
tacaagctcttgaagacgcaacacctcagcaacgaccatatctgctattttctttaccag
atcctcagagggttaaaatatatccattcagccaatgtactgcaccgtgacctcaaacct
tccaacctgctgctcaataccacctgcgatctcaagatctgtgactttggcttggcccgt
gttgcagatccggaccacgatcacacagggttcctgacggagtatgtagccacacgctgg
tacagggctccggaaattatgttgaattccaagggctataccaagtccattgatatttgg
tctgtaggctgcattctggcagagatgctgtccaacaggcccatcttcccggggaagcat
tatctcgaccagctgaaccacattctgggtattcttggatccccatcacaggaagacctg
aactgtataataaatttaaaagctagaaactacttgctttctcttccacacaaaaataag
gtgccatggaacaggctgttcccaaatgctgactccaaagctctggatttactggacaag
atgttgacattcaaccctcacaagaggattgaagtagagcaggctctggcccatccatat
ctggagcagtattacgacccaagcgatgagcccatcgctgaggcgccattcaagtttgac
atggagctggatgacctgcccaaggaaaagctcaaagaactcatcttcgaagagacagct
agattccagccgggatacagatcttaa

KEGG   Ailuropoda melanoleuca (giant panda): 100472388
Entry
100472388         CDS       T01329                                 

Gene name
MAPK3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04114  Oocyte meiosis
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04218  Cellular senescence
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04350  TGF-beta signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04371  Apelin signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04520  Adherens junction
aml04540  Gap junction
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04668  TNF signaling pathway
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04726  Serotonergic synapse
aml04730  Long-term depression
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04921  Oxytocin signaling pathway
aml04926  Relaxin signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml04929  GnRH secretion
aml04930  Type II diabetes mellitus
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml05010  Alzheimer disease
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05034  Alcoholism
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100472388 (MAPK3)
   04012 ErbB signaling pathway
    100472388 (MAPK3)
   04014 Ras signaling pathway
    100472388 (MAPK3)
   04015 Rap1 signaling pathway
    100472388 (MAPK3)
   04350 TGF-beta signaling pathway
    100472388 (MAPK3)
   04370 VEGF signaling pathway
    100472388 (MAPK3)
   04371 Apelin signaling pathway
    100472388 (MAPK3)
   04668 TNF signaling pathway
    100472388 (MAPK3)
   04066 HIF-1 signaling pathway
    100472388 (MAPK3)
   04068 FoxO signaling pathway
    100472388 (MAPK3)
   04072 Phospholipase D signaling pathway
    100472388 (MAPK3)
   04071 Sphingolipid signaling pathway
    100472388 (MAPK3)
   04024 cAMP signaling pathway
    100472388 (MAPK3)
   04022 cGMP-PKG signaling pathway
    100472388 (MAPK3)
   04151 PI3K-Akt signaling pathway
    100472388 (MAPK3)
   04150 mTOR signaling pathway
    100472388 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100472388 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100472388 (MAPK3)
   04210 Apoptosis
    100472388 (MAPK3)
   04218 Cellular senescence
    100472388 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100472388 (MAPK3)
   04520 Adherens junction
    100472388 (MAPK3)
   04540 Gap junction
    100472388 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100472388 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100472388 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100472388 (MAPK3)
   04620 Toll-like receptor signaling pathway
    100472388 (MAPK3)
   04621 NOD-like receptor signaling pathway
    100472388 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    100472388 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    100472388 (MAPK3)
   04660 T cell receptor signaling pathway
    100472388 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    100472388 (MAPK3)
   04659 Th17 cell differentiation
    100472388 (MAPK3)
   04657 IL-17 signaling pathway
    100472388 (MAPK3)
   04662 B cell receptor signaling pathway
    100472388 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    100472388 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    100472388 (MAPK3)
   04062 Chemokine signaling pathway
    100472388 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100472388 (MAPK3)
   04929 GnRH secretion
    100472388 (MAPK3)
   04912 GnRH signaling pathway
    100472388 (MAPK3)
   04915 Estrogen signaling pathway
    100472388 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    100472388 (MAPK3)
   04917 Prolactin signaling pathway
    100472388 (MAPK3)
   04921 Oxytocin signaling pathway
    100472388 (MAPK3)
   04926 Relaxin signaling pathway
    100472388 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    100472388 (MAPK3)
   04919 Thyroid hormone signaling pathway
    100472388 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    100472388 (MAPK3)
   04916 Melanogenesis
    100472388 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100472388 (MAPK3)
   04270 Vascular smooth muscle contraction
    100472388 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100472388 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100472388 (MAPK3)
   04725 Cholinergic synapse
    100472388 (MAPK3)
   04726 Serotonergic synapse
    100472388 (MAPK3)
   04720 Long-term potentiation
    100472388 (MAPK3)
   04730 Long-term depression
    100472388 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    100472388 (MAPK3)
   04722 Neurotrophin signaling pathway
    100472388 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    100472388 (MAPK3)
   04380 Osteoclast differentiation
    100472388 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100472388 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100472388 (MAPK3)
   05206 MicroRNAs in cancer
    100472388 (MAPK3)
   05205 Proteoglycans in cancer
    100472388 (MAPK3)
   05203 Viral carcinogenesis
    100472388 (MAPK3)
   05230 Central carbon metabolism in cancer
    100472388 (MAPK3)
   05231 Choline metabolism in cancer
    100472388 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100472388 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100472388 (MAPK3)
   05212 Pancreatic cancer
    100472388 (MAPK3)
   05225 Hepatocellular carcinoma
    100472388 (MAPK3)
   05226 Gastric cancer
    100472388 (MAPK3)
   05214 Glioma
    100472388 (MAPK3)
   05216 Thyroid cancer
    100472388 (MAPK3)
   05221 Acute myeloid leukemia
    100472388 (MAPK3)
   05220 Chronic myeloid leukemia
    100472388 (MAPK3)
   05218 Melanoma
    100472388 (MAPK3)
   05211 Renal cell carcinoma
    100472388 (MAPK3)
   05219 Bladder cancer
    100472388 (MAPK3)
   05215 Prostate cancer
    100472388 (MAPK3)
   05213 Endometrial cancer
    100472388 (MAPK3)
   05224 Breast cancer
    100472388 (MAPK3)
   05223 Non-small cell lung cancer
    100472388 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100472388 (MAPK3)
   05020 Prion disease
    100472388 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    100472388 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    100472388 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100472388 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100472388 (MAPK3)
   04934 Cushing syndrome
    100472388 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100472388 (MAPK3)
   05135 Yersinia infection
    100472388 (MAPK3)
   05133 Pertussis
    100472388 (MAPK3)
   05152 Tuberculosis
    100472388 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100472388 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    100472388 (MAPK3)
   05161 Hepatitis B
    100472388 (MAPK3)
   05160 Hepatitis C
    100472388 (MAPK3)
   05171 Coronavirus disease - COVID-19
    100472388 (MAPK3)
   05164 Influenza A
    100472388 (MAPK3)
   05163 Human cytomegalovirus infection
    100472388 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100472388 (MAPK3)
   05165 Human papillomavirus infection
    100472388 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100472388 (MAPK3)
   05140 Leishmaniasis
    100472388 (MAPK3)
   05142 Chagas disease
    100472388 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100472388 (MAPK3)
   01524 Platinum drug resistance
    100472388 (MAPK3)
   01522 Endocrine resistance
    100472388 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100472388 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100472388 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100472388 (MAPK3)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100472388 (MAPK3)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100472388 (MAPK3)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100472388 (MAPK3)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100472388 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 100472388
NCBI-ProteinID: XP_034526049
Ensembl: ENSAMEG00000015300
LinkDB
Position
10
AA seq 325 aa
MVSSAYDHVRKIRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEA
MRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLI
NTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAK
LFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDD
LPKERLKELIFQETARFQPGALEAP
NT seq 978 nt   +upstreamnt  +downstreamnt
atggtcagctcagcttacgaccacgtgcgcaagattcgcgtggccatcaagaaaatcagc
cccttcgagcatcagacctactgccagcgcacactgcgggagatccagatcttgctgcgc
ttccgccacgagaacgtcattggcattcgggacattctgcgggcgcccaccctggaagcc
atgagagatgtctacattgtgcaggacctgatggagacagacctgtacaagttgctcaaa
agccagcagctgagcaacgaccatgtttgctacttcctctaccagatcctgcggggcctc
aagtatatccactcagccaacgtgctccaccgggatctaaagccctccaacctgcttatc
aacaccacctgcgaccttaagatctgcgattttggcctggcccggattgcggaccctgag
catgaccacaccggcttcctgacagaatatgtggccacacgctggtaccgggctccagaa
atcatgcttaactctaagggctacaccaagtccatcgacatctggtctgtgggctgcatt
ctggctgagatgctctccaaccggcccatcttccctggcaagcactacctggaccagctc
aaccacattctgggtatcctcggctccccatcccaggaggacttgaattgtatcatcaat
atgaaggcccgaaactacctgcagtctctgccctccaagaccaaggtggcctgggccaag
ctttttcccaagtcggactcaaaagcccttgacctgctagaccggatgttgacctttaac
cccaacaaacggatcacagtggaagaagcactggctcacccctacttggagcagtactac
gacccaacagatgagccagtggccgaggagcctttcacctttgacatggagctggatgat
ctacccaaggagcggctgaaggagctcatcttccaggagacagcccgcttccagcctggg
gcgctggaggccccctaa

DBGET integrated database retrieval system