KEGG   Ailuropoda melanoleuca (giant panda): 100470573
Entry
100470573         CDS       T01329                                 

Gene name
CBL
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL isoform X1
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04012  ErbB signaling pathway
aml04120  Ubiquitin mediated proteolysis
aml04144  Endocytosis
aml04910  Insulin signaling pathway
aml05100  Bacterial invasion of epithelial cells
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100470573 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100470573 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100470573 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100470573 (CBL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100470573 (CBL)
   05205 Proteoglycans in cancer
    100470573 (CBL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100470573 (CBL)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100470573 (CBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100470573 (CBL)
   04121 Ubiquitin system [BR:aml04121]
    100470573 (CBL)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100470573 (CBL)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100470573 (CBL)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    100470573 (CBL)
SSDB
Motif
Pfam: Cbl_N3 Cbl_N Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4
Other DBs
NCBI-GeneID: 100470573
NCBI-ProteinID: XP_034521855
Ensembl: ENSAMEG00000007928
LinkDB
Position
8
AA seq 904 aa
MGRGVMDHFLWSCAFFNISATEHIFYNLFFFNLKKEIVLKILQVIALLFHLLQVVRLCQN
PKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISL
FKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRK
AFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWS
SLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADG
NILQTIPHNKPLFQALIDGFREGFYLFPDGRSQNPDLTGLCEPTPQDHIKVTQEQYELYC
EMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVD
PFDPRGSGSLLRQGAEGAPSPNYEDDDDERADDSLFMMKELAGAKFYLCQVERPPSPFSM
APQASLPPVPPRLDLLQQRVSLPSSASGLGTASKVASGSLHKDKPLPIPPTLRDLPPPPP
PDRPYSVGAETRPQRRPLPCTPGDCPSRDKLPPVPSSRLGESWLPRPIPKVPVVAPNAGD
PWTGRELTNRHSLPFSLPSQMEPRTDVSRLGSTFNVDTSMNVNNSPLAGSECEHPKIKPS
ASASAIYSLAARPLPVPKLPPGEQCDSEEDTEYMTPSSRPLGLPKPDGKRPLETTQSSRA
CECDQQTESCTYEAMYNIQSQATPAAPESSSFGEGHLAAGRAGAGPEGSENEEDGYDVPK
PPVPAVLARRTLSDISNASSSFGWLSLEGDPPTHFAEGSQVPERPPKPFPRRINSERKAG
SCQQGGAAAASSPQLSSEIENLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPA
HVAT
NT seq 2715 nt   +upstreamnt  +downstreamnt
atgggcaggggtgttatggatcatttcttatggtcttgtgcattttttaatatttctgca
acagagcacatattttataacttatttttttttaatttaaaaaaggaaattgtccttaag
atcctccaagtaatagcccttcttttccatttgttgcaggtggtgcggttgtgtcagaac
ccaaagctggcgctaaagaatagcccaccttatatcttagacctgctgccagatacctac
cagcatctccgcactatcttgtcaagatatgaggggaagatggagacgcttggagaaaat
gagtattttagggtgttcatggagaacttgatgaagaaaactaagcagaccataagcctc
ttcaaggaggggaaagaaaggatgtatgaggagaattctcagcctaggagaaacctaacc
aaactatccctgatcttcagccacatgctggcagaactaaaaggaatctttccaagtgga
ctctttcaaggagacacatttcggattacgaaggcagatgctgcagagttttggaggaaa
gcttttggggaaaagacaatagtcccttggaagagtttccggcaggcccttcatgaggtg
catcccatcagttctgggctcgaggccatggctctgaaatccactattgatctgacctgc
aatgattatatttcagtttttgaatttgacatcttcacacgactctttcagccctggtcc
tctttgctcaggaattggaacagtcttgccgtgacgcatcctggctacatggctttcctg
acgtatgacgaagtgaaagctcggctccagaagttcattcacaaacctggcagttacatt
ttccggctgagctgcactcgtctgggtcagtgggctattggatatgtcactgctgatggg
aacattctccagacgatccctcacaataaacctctcttccaagccctgattgatggcttc
agggaaggcttctatctgtttccagatggacggagtcagaatcctgacctgacaggctta
tgtgaacccactccccaggaccacatcaaagtgacccaggaacaatatgaattatactgt
gagatgggctccaccttccagctgtgtaaaatctgcgctgaaaacgacaaggatgtgaaa
attgagccctgtggacacctcatgtgcacgtcctgtctcacatcctggcaggaatcagaa
ggccagggctgtcctttctgccgatgtgaaattaaaggtaccgagcccattgtggtagat
ccgtttgaccctcgaggaagtggcagcctcctgaggcaaggagccgagggagctccctcc
ccaaattacgaggacgatgacgatgaacgagctgatgattctctctttatgatgaaggaa
ctggctggtgccaagttttatttgtgtcaggtggaacggcctccttctccgttttcgatg
gccccacaagcttcccttcccccggtgccaccgcgacttgaccttctgcaacagcgggtg
tcccttccttcaagtgcttctggtcttggaactgcttctaaggtagcttctggctccctt
cataaggacaaaccattaccaatacctcccacacttcgagatcttccaccaccaccccct
ccggaccggccatattctgttggagcagaaacccggcctcagagacgtcccttgccttgt
acaccgggcgactgtccatccagggacaaactgccccctgttccctctagccgccttggg
gaatcgtggctgcctcggccaatccccaaagtaccagtggttgccccaaacgctggtgac
ccctggacaggtagagaattaaccaacaggcactcgcttccattttcattgccctcacaa
atggaacccagaacagatgtgtccaggcttggaagcacattcaatgtggatacctccatg
aatgtgaataacagcccattagcaggttcagagtgtgagcaccccaaaatcaagccttct
gcatctgccagtgccatttactctctggctgccaggcctcttcctgtgccaaagctgccc
cctggggagcagtgtgacagtgaggaggacaccgagtatatgaccccctcctccagacct
ctagggcttccaaagccagatgggaaacggcctttggagacaacccagagttcacgagcg
tgtgagtgtgaccagcagaccgagagctgtacatatgaagcaatgtataatattcagtcc
caggcgacgccagctgccccggagagcagctccttcggtgaagggcatctggctgcgggc
cgcgcaggcgccggccccgagggatcagagaatgaggaagacggctatgacgtccctaag
cctccagtgccggccgtgctggcccgccggaccctctcagacatctctaacgccagctcc
tccttcggctggttgtctctggaaggcgatcctcccacacacttcgctgaggggtcccag
gttcctgagaggcctcccaaaccattccctcggagaatcaactcggagcggaaagcaggc
agctgtcagcagggtggcgccgcggccgcctcctcgccgcagctctccagtgagatcgag
aacctcatgagccaggggtactcctaccaggacattcagaaagccctggtcattgcccac
aacaacatcgaaatggccaagaatatcctccgggaatttgtttctatctcgtctcccgcc
cacgtcgccacctag

DBGET integrated database retrieval system