KEGG   Ailuropoda melanoleuca (giant panda): 100470969
Entry
100470969         CDS       T01329                                 

Gene name
CTBP2
Definition
(RefSeq) C-terminal-binding protein 2 isoform X1
  KO
K04496  C-terminal binding protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04330  Notch signaling pathway
aml05200  Pathways in cancer
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100470969 (CTBP2)
   04330 Notch signaling pathway
    100470969 (CTBP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100470969 (CTBP2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100470969 (CTBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100470969 (CTBP2)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Macropinocytosis
   Others
    100470969 (CTBP2)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Other DBs
NCBI-GeneID: 100470969
NCBI-ProteinID: XP_011232358
LinkDB
Position
6
AA seq 445 aa
MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFC
DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG
IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRG
ETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVS
LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES
EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE
FFVTTAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV
AHPSQAPSPNQPTKHGDNREHPNEQ
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcccttgtggataagcacaaagtcaagcgacagcgattggacagaatttgtgaaggt
atccgcccccagatcatgaacggccccctgcacccccgccccctggtggcgctgctcgac
ggcagagactgcaccgtggagatgcccatcctgaaggacctggccaccgtggccttctgt
gatgcacagtccactcaggagatccacgagaaggttctaaacgaagccgtgggcgccatg
atgtaccacaccatcaccctcaccagggaggacctggagaagttcaaggccctgagagtg
atcgtgcggataggcagcggctacgacaacgttgacatcaaggctgccggcgagctcggc
atcgccgtgtgcaacatcccatccgcggccgtggaagagacggccgactccaccatctgc
cacatccttaacctgtaccggcggaacacgtggctgtaccaggcgctgcgggaaggcacg
cgggtccagagcgttgagcagatccgggaggtggcctcgggagcagcccgcatccgcggg
gagacgctgggcctcatcggcttcggtcgcacggggcaggcggttgctgttcgagccaag
gcctttggattcagcgtcatattttatgacccctacttgcaggatgggatcgaaaggtcc
cttggcgtgcagagggtctacaccctgcaggacttattgtatcagagcgactgtgtctcc
ttgcactgtaatctcaacgagcataaccaccatctcatcaatgactttactataaagcag
atgaggcaaggggcattcctagtgaatgcggcccgcggcgggctggtggatgagaaagcc
ttagctcaagccctcaaggaaggcaggatacgaggggcagccctcgacgtgcacgaatcg
gagcctttcagctttgctcagggtcctttgaaagatgcaccgaatctcatttgtacgccc
cacacagcttggtatagtgagcaagcctcactagagatgagggaggcagccgccaccgag
atccgccgggccatcacaggtcgcatccccgaaagcttaagaaactgtgtgaacaaggaa
ttcttcgtcacaacagctccctggtcagtaatagatcagcaagcaatccatccggagctc
aacggcgccacgtacagatacccgccaggcatcgtgggggtggctccgggcggacttcct
gcagccatggaagggatcatccccggaggcatcccggtgactcacaacctccccacagtg
gcacacccttcccaagctccctctcccaaccagcctacaaaacacggggacaatagagag
caccccaatgagcaatag

KEGG   Ailuropoda melanoleuca (giant panda): 100484032
Entry
100484032         CDS       T01329                                 

Gene name
CTBP1
Definition
(RefSeq) C-terminal-binding protein 1 isoform X2
  KO
K04496  C-terminal binding protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04330  Notch signaling pathway
aml05200  Pathways in cancer
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100484032 (CTBP1)
   04330 Notch signaling pathway
    100484032 (CTBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100484032 (CTBP1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100484032 (CTBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100484032 (CTBP1)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Macropinocytosis
   Others
    100484032 (CTBP1)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 XdhC_C Cellsynth_D
Other DBs
NCBI-GeneID: 100484032
NCBI-ProteinID: XP_011229592
Ensembl: ENSAMEG00000016883
LinkDB
Position
11
AA seq 429 aa
MSGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAV
GALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADS
TMCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVAL
RAKAFGFNVLFYDPYLSDGTERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFT
VKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLI
CTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATHWASMDPAVVH
PELNGAAYRYPPGVVGVAPSGIPTAVEGIVPSAMSLSHGLPPVSHPPHAPSPGQTVKPEA
DRDHASDQL
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtcaggcgtccgacccccgatcatgaacgggcccatgcatcccaggcccctggtggca
ctgctcgacggccgggactgcacggtggagatgcccatcctgaaggacgtggccaccgtg
gccttctgtgacgcgcagtccacacaggagatccacgagaaggtgctgaacgaggccgtg
ggggcgctgatgtaccacaccatcacgctgaccagggaggacctggagaagttcaaagct
ctccgcatcattgtgaggatagggagcggtttcgacaacatcgacatcaagtcggccggg
gacttaggcattgctgtctgcaacgtgccggcggcgtctgtcgaggagaccgctgactcc
accatgtgccacatcctgaacctgtaccgcaggaccacgtggctgcaccaggcgctgcgg
gagggcacgcgggtccagagcgttgagcagatccgggaagtcgcatccggagccgccagg
atccgtggggagaccttgggcatcatagggctgggtcgcgtggggcaggcggtggcgctc
cgggccaaggcgttcggtttcaacgtgctcttctatgacccgtacctgtcggacggcacc
gagcgggcgctggggctgcagcgggtcagcacgctgcaggacctgctgttccacagtgac
tgcgtgacgctgcactgtggcctcaacgagcacaaccaccacctcatcaacgatttcacc
gtcaagcagatgcgacaaggcgccttcctggtgaacacggcccggggcggcttggtggac
gagaaggccctggcccaggccctgaaggaggggcggatccggggcgctgccctcgacgtg
cacgagtcggagcccttcagctttagccagggcccgctgaaggacgcacccaacctgatc
tgcaccccccacgcggcctggtacagcgagcaggcgtccatcgagatgcgggaggaggca
gcccgggaaatccggagagccatcacaggccgcatccccgacagcctgaagaactgtgtc
aacaaggaccacctgaccgccgccacccactgggccagcatggacccagccgtcgtgcac
cctgagctcaacggggccgcctacaggtacccgccgggcgtggtgggcgtggcccccagc
ggcatcccgactgccgtggaaggcattgtccccagcgccatgtccctgtcccacggcctg
ccccccgtgtcccacccgccccacgccccttctcccggccaaaccgtcaagcccgaggca
gatagagaccacgcgagtgaccagttgtag

DBGET integrated database retrieval system