KEGG   Ailuropoda melanoleuca (giant panda): 100473242
Entry
100473242         CDS       T01329                                 

Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04630  JAK-STAT signaling pathway
aml04640  Hematopoietic cell lineage
aml04664  Fc epsilon RI signaling pathway
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05221  Acute myeloid leukemia
aml05310  Asthma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100473242
   04151 PI3K-Akt signaling pathway
    100473242
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100473242
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100473242
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100473242
   04664 Fc epsilon RI signaling pathway
    100473242
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100473242
   05202 Transcriptional misregulation in cancer
    100473242
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100473242
  09163 Immune disease
   05310 Asthma
    100473242
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100473242
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100473242
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Interleukins
   100473242
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Haparin
  Cytokines
   100473242
SSDB
Motif
Pfam: IL3 CSTF2_hinge
Other DBs
NCBI-GeneID: 100473242
NCBI-ProteinID: XP_011222366
Ensembl: ENSAMEG00000017657
LinkDB
Position
3
AA seq 142 aa
MNSLPILHVLLLLLGLRAPMAQGRSLSTYQPKQYFEMISEIMDILNNSPSPSEETLDPNE
TSTLLNTTLLRPNLEAFLNATKNFYNSESLIWKNLKEFLPLLPTPTPRGQPISIENNLGD
FQKKLKKYLEALDNFLNFKNKQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaacagcctccccatcctgcacgttctcctgctcctgcttggactccgagccccaatg
gcacaggggcgctccttgtccacataccagcctaagcaatacttcgagatgatcagtgaa
attatggacatcttaaacaattcaccctcgccttcagaagaaaccttggacccaaatgag
acaagcaccctgctgaacactacccttctgaggccaaacctggaagcattcttgaatgct
accaaaaatttctacaacagtgaatcgctaatctggaaaaatcttaaggaattcctgcca
ctcctgcccactcccacacccaggggacaaccaatctctattgagaataacttgggtgat
tttcaaaagaagctgaaaaagtatctggaagcccttgacaactttctgaatttcaagaac
aagcaatga

DBGET integrated database retrieval system