KEGG   Ailuropoda melanoleuca (giant panda): 100473254
Entry
100473254         CDS       T01329                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X3
  KO
K05459  insulin-like growth factor 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04114  Oocyte meiosis
aml04115  p53 signaling pathway
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04510  Focal adhesion
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04730  Long-term depression
aml04750  Inflammatory mediator regulation of TRP channels
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05205  Proteoglycans in cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05410  Hypertrophic cardiomyopathy
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100473254 (IGF1)
   04014 Ras signaling pathway
    100473254 (IGF1)
   04015 Rap1 signaling pathway
    100473254 (IGF1)
   04066 HIF-1 signaling pathway
    100473254 (IGF1)
   04068 FoxO signaling pathway
    100473254 (IGF1)
   04151 PI3K-Akt signaling pathway
    100473254 (IGF1)
   04152 AMPK signaling pathway
    100473254 (IGF1)
   04150 mTOR signaling pathway
    100473254 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100473254 (IGF1)
   04115 p53 signaling pathway
    100473254 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100473254 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100473254 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100473254 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    100473254 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    100473254 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100473254 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    100473254 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100473254 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    100473254 (IGF1)
   04213 Longevity regulating pathway - multiple species
    100473254 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100473254 (IGF1)
   05202 Transcriptional misregulation in cancer
    100473254 (IGF1)
   05205 Proteoglycans in cancer
    100473254 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    100473254 (IGF1)
   05218 Melanoma
    100473254 (IGF1)
   05215 Prostate cancer
    100473254 (IGF1)
   05224 Breast cancer
    100473254 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100473254 (IGF1)
   05414 Dilated cardiomyopathy
    100473254 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100473254 (IGF1)
   01522 Endocrine resistance
    100473254 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100473254 (IGF1)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100473254 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100473254
NCBI-ProteinID: XP_002915500
UniProt: Q6JLX1
LinkDB
Position
15
AA seq 153 aa
MGKISSLPTQLFKCCFCDFLKVKMHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKEVHLKNASRGSAGNKNYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaactcaattatttaagtgctgcttttgtgatttcttg
aaggtaaagatgcacatcatgtcttcctcgcatctcttctacctggccctgtgcttgctc
accttcaccagctctgccacagctggaccggagacactctgtggggctgagttggtggac
gctcttcagttcgtgtgtggagacaggggtttttatttcaacaagcccaccgggtatggc
tccagcagtcggagggcacctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctgaggaggttagagatgtactgcgcacccctcaagcctgccaagtccgcccgctca
gtccgtgcccagcgccacaccgacatgcccaaggctcagaaggaagtacatttgaagaac
gcaagtagagggagtgcaggaaacaagaactacagaatgtag

DBGET integrated database retrieval system