KEGG   Ailuropoda melanoleuca (giant panda): 100473379
Entry
100473379         CDS       T01329                                 

Gene name
LRP5
Definition
(RefSeq) LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05200  Pathways in cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100473379 (LRP5)
   04150 mTOR signaling pathway
    100473379 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100473379 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100473379 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100473379 (LRP5)
   05226 Gastric cancer
    100473379 (LRP5)
   05224 Breast cancer
    100473379 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100473379 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    100473379 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100473379 (LRP5)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100473379 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition DUF5050 Ldl_recept_a SGL Insulin_TMD DUF5653 EGF
Other DBs
NCBI-GeneID: 100473379
NCBI-ProteinID: XP_034502499
Ensembl: ENSAMEG00000001320
LinkDB
Position
16
AA seq 1315 aa
MGAGVRLGGARSTWGPRSSPFASAPAASPLLLFANRRDVRLVDAGGVKLESTVVVSGLED
AAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGVAVQNVVISGLVSPDGLACDWVGKKLYW
TDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGS
TRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALT
LSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSSERQPYFHTRCAEDNG
GCSHLCLLSPREPFYTCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTD
IVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVD
WVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGYIYWTEWGGKPRI
VRAFMDGTNCMTLVDKVGRANDLTIDYVDQRLYWTDLDTNMIESSDMLGQERVVIADDLP
HPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDC
MHNNGQCGQLCLAIPGGHRCGCASHYTLXPPSPLAPPSRNCSPPTAFLLFSQKCAISRMI
PDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSPSQSQ
NPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLNGDAMGVVLRGDRDKPRAIVVNAERGY
LYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNRLGKLFWVDADLKRIESCD
LSGANRLTLEDANIVQPVGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTG
IHAVEDVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCS
PDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGE
ADCQDRSXXXXXXAVCLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDS
PAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAP
GSSQHGPFTGISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNP
PPSPATDPSLYNVDVFYSSNIPTTTRPYRPYIIRGMAPPTTPCSTDVCDSDYSANRWKAS
KYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
NT seq 3948 nt   +upstreamnt  +downstreamnt
atgggggccggggtgcggctgggtggggccaggagcacttggggcccgcggtcctcaccg
ttcgcttccgcccccgcagcctcgccgctcctgctgttcgccaaccgccgggacgtgcgg
ctggtggacgccggcggagtcaagctggagtccactgttgtggtcagcggcctggaggac
gcggctgccgtggatttccagttctccaagggagctgtgtactggacagacgtgagcgag
gaggccatcaagcagacctacctgaaccagacgggggtcgccgtgcagaacgtggtcatc
tctggcctggtgtcgcccgacggcctggcctgcgattgggtcggcaagaagctgtactgg
acggactcagagaccaaccgcatcgaggtggccaacctcaatgggacgtcccggaaggtc
ctcttctggcaggacctcgaccagccgcgggccatcgccttggaccccgctcacgggtac
atgtactggacagactggggcgagacacctcgaatcgagcgggcggggatggatggcagc
acccggaaaatcatagtggactccgacatttactggcccaacgggctgaccatcgacttg
gaggagcagaagctctactgggccgacgccaagctcagctttatccaccgtgccaacctg
gatggttcgttccggcagaaggtggtggagggcagcctgacgcacccctttgccctgacg
ctctctggggacactctgtactggacggactggcagacccgctccatccacgcctgtaac
aagaggactggagagaagaggaaggagatccttagcgccctttattcgcccatggatatt
caagtgctcagctcagagcggcagccttacttccacacacggtgtgcagaggacaatggc
ggctgctcccacctgtgcctgctgtccccgagggagcctttctacacgtgcgcctgtccc
actggtgtgcagcttcaggacaacggcaagacgtgcaaggcaggggccgaggaggtgctg
ctgcttgcccggcggacggacctgcggaggatctcgctggacacgccggactttaccgac
atcgtgctacaggttgatgacatccggcacgccattgccatcgactacgacccgctggag
ggctacgtctactggacggatgacgaggtgcgggccatccgcagggcatacctggacggg
tcgggggcacagacactggtcaacactgagatcaacgaccccgacggcatcgcggttgac
tgggtggcccgcaacctctactggacggacacgggcaccgaccgcattgaggtgacccgt
ctcaacggcacctcccgcaagatcctggtgtccgaggacctggacgagccccgggccatc
gtgctgcaccccgtgatgggctacatctactggaccgagtggggtggcaaacccaggatc
gtgcgggctttcatggacgggaccaactgcatgacgctggtggacaaggtgggtcgggcc
aatgacctcaccatcgactatgtggaccagcgtctctactggaccgacctggacaccaac
atgatcgagtcatctgacatgctgggtcaggagcgcgtcgtgattgccgacgacctccca
caccccttcggcctgacgcagtacagcgattacatctactggaccgactggaacctgcac
agcatcgagagggccgacaagaccagcggccggaaccgcaccctcatccagggccatctg
gacttcgtgatggacatcctggtgttccactcctcccgccaggatggcctcaatgattgc
atgcacaacaacgggcagtgtgggcagctgtgcctcgccatccctggcggccaccgctgt
ggctgtgcctcccactacaccctantccccccctcccccctagccccccccagccgcaac
tgcagcccgcccaccgccttcttgctgttcagccagaaatgtgccatcagccgcatgatc
cccgacgaccagcacagcccagacctcatcctgccactgcacgggctgaggaacgtcaag
gccatcgactatgacccactggacaagttcatctactgggtggatgggcgccaaaacatt
aagcgggccaaggacgacgggacccagcccttcgttttgacctctccaagccagagccaa
aacccggacaggcagccccacgatctcagcatcgacatctatagccggacgctgttctgg
acgtgtgaggctaccaacaccatcaacgtccaccggctgaacggagacgccatgggtgtg
gtgctccgtggggaccgcgacaagccgcgggccatcgtcgtcaacgccgagcgagggtac
ctgtacttcaccaacatgcaggaccgtgcggccaagatcgagcgagccgccctggacggc
accgagcgtgaggtcctcttcaccaccggcctcatccggcccgtggccctcgtggtggac
aacaggctgggcaagctcttctgggtggacgcagacctgaagcgcatcgaaagctgtgac
ctgtcaggggccaaccgcctgaccctggaggatgccaacatcgtgcagcccgtgggcctg
accgtgctgggcaagcacctctactggattgaccggcagcagcagatgatcgagcgtgtg
gagaagaccaccggggacaagcggacacgagtccagggccgagtcgcccacctgacgggc
atccacgccgtggaggatgtcagcctagaggagttctcggcccacccgtgtgcccgggac
aacggcggctgctctcacatctgcattgccaagggtgacgggacaccacggtgctcatgc
ccggtccacctcgtgctcctgcagaacctgctgacctgtggtgagcctcccacctgctcc
ccggaccagttcgcgtgtgccaccggggagatcgactgcatccccggggcctggcgctgc
gatggcttccccgagtgtgacgaccagagcgacgaggagggctgcccggtatgctcggcc
gcccagttcccctgcgcgcggggccagtgcgtggacctgcgcctgcgctgcgacggcgag
gccgactgccaggaccgctcnnnnnnnnnnnnnnnnncagccgtctgcctgcccaaccag
ttccgctgcgccagcggccagtgcgtcctcatcaagcagcagtgcgattccttccccgac
tgcatcgacggctccgatgagctcatgtgcgagatcaccaagccgccgtctgatgacagc
ccggcccacagcagcgccatcgggccggtcatcggcatcatcctgtccctcttcgtcatg
ggcggcgtctacttcgtctgccagcgtgtggtgtgtcagcgctacgccggggccaacggg
ccctttccgcacgagtacgtcagtgggaccccccacgttcccctcaatttcatagccccg
ggcagctcacagcatggtcccttcacaggcatctcctgtggcaagtccatgatgagctct
gtgagcctgatggggggccggggcggagtgcccctctatgaccggaaccacgtcaccggg
gcctcgtccagcagctcgtccagcaccaaggccaccctgtaccctccgatcctgaaccca
ccgccatcccccgccacggacccctccttgtacaacgtggacgtgttctactcctccaac
attcccaccaccacgagaccctacaggccctacatcatccgaggcatggcgccccccacg
acgccctgcagcaccgatgtttgcgacagtgactacagtgccaaccgctggaaggccagc
aagtattacctggatttgaactcggactcagacccctacccgccgccgcccacgccccac
agccagtacctgtcggcggaggacagctgccccccttcaccggccaccgagaggagctac
tttcacctcttcccgccccctccgtccccctgcacggactcgtcctga

KEGG   Ailuropoda melanoleuca (giant panda): 100477840
Entry
100477840         CDS       T01329                                 

Gene name
LRP6
Definition
(RefSeq) low-density lipoprotein receptor-related protein 6 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04150  mTOR signaling pathway
aml04310  Wnt signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05200  Pathways in cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100477840 (LRP6)
   04150 mTOR signaling pathway
    100477840 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100477840 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477840 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100477840 (LRP6)
   05226 Gastric cancer
    100477840 (LRP6)
   05224 Breast cancer
    100477840 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100477840 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    100477840 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100477840 (LRP6)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100477840 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 100477840
NCBI-ProteinID: XP_034500666
Ensembl: ENSAMEG00000001930
LinkDB
Position
16
AA seq 1613 aa
MGAVLRSLLACSFCALLRAAPLLLYANRRDLRLVDATNGRENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTE
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCSNGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagtttctgtgcgctcctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgcgattggttgatgctacaaatggcaga
gagaatgctacgattgtagttggaggcttggaggatgcagctgcggtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacgaacagagttt
aacaaaactgagagtgtacagaatgttgttgtctctggattattgtcccctgatgggctg
gcatgtgattggcttggagaaaagttatactggacagattctgaaacaaatcggattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagaattggatcaaccc
agagctattgccttagatccttcaagtgggttcatgtactggacagactggggagaagta
ccaaagatagaacgtgctggaatggacggttcaagtcgattcattataataaacactgaa
atttactggccaaatggactgactttggattatgaggaacagaagctttattgggcagat
gcaaaactcaatttcatccacaaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacattatttgaggacacgttgtactggacc
gactggaatacacactctattttggcttgcaacaagtacactggcgagggtctgcgtgaa
atccattctaacatcttctctcccatggatatacatgccttcagccaacagaggcagcca
aatgctacaaatccatgtggaattgataatggtggttgttcccacttgtgtttgatgtct
ccagtcaaacctttttatcagtgtgcttgcccaactggggtcaaactcctggagaatgga
aaaacctgcaaagatggtgccactgaattactgcttttagcacgaaggacagacttgaga
cgcatttctttggatacaccagatttcacagacattgttttacagttagaagacatccgt
catgccattgccatagattatgatcctgtggaaggctatatctactggactgatgatgaa
gtgagggccatacgccgctcattcatagatggatctggcagtcagtttgtggtcactgct
caaattgcgcatcctgatggtattgctgttgactgggttgcccgaaatctttattggaca
gacactggcactgatcggatagaagttacaaggctcaatgggaccatgaggaagatcttg
atttcagaggacttagaggaaccccgagccattgtgttagatcccatggttgggtacatg
tattggactgactggggagaaatcccgaaaattgagcgagcagctctggatggttctgac
cgagtagtgttggttaacacttctcttggttggccaaacggtttagccttggattatgat
gaaggcaaaatatactggggagatgccaaaacagacaaaattgaggttatgaatactgat
ggcactgggagacgagtactagtggaagacaaaattcctcacatatttgggtttactttg
ttgggtgactatgtttactggactgactggcagagacgtagcatcgaaagagtacacaaa
cgaagcgcagagagggaaatcatcatagatcagcttcctgacctcatgggcctaaaggcc
acaaatgttcatcgaatcattggttccaacccctgtgctgaggaaaatgggggatgtagc
catctttgcctctataggcctcagggcctccgctgtgcctgccccattggctttgaactc
atcagtgacatgaagacctgcattgtcccagaggctttccttttgttttcacggagagca
gatatcaggcgaatttctttggaaactaacaataataatgtggccattcctctcactggt
gtcaaagaagcttctgctttggattttgatgtaacagacaaccgcatttactggactgat
atatcactcaagaccatcagcagagcctttatgaatggcagtgcgctggaacatgtggta
gaattcggcttagattatccagaaggcatggcagtagactggctggggaagaacttgtac
tgggcagacacaggaacgaatcgaattgaggtgtcaaagttggatgggcagcaccgacaa
gttttggtgtggaaagacttagatagtcccagagctcttgcactggaccctgctgaagga
tttatgtattggactgaatggggtggaaaacctaagatagaccgagctgccatggatgga
agtgaacgtactacattagttccaaatgtgggacgggcaaatggcctaactattgattat
gctaaaaggaggctttattggacagacctggacaccaacttaatagaatcttcaaatatg
cttggactcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattacatctactggacggactggagccgacgcagcattgaacgtgccaacaaa
actagtggccaaaaccgcaccatcattcagggccatttggattatgtgatggacatcctc
gtctttcactcctctcggcaggcggggtggaatgagtgtgcttccagcaatgggcactgc
tcccacctctgcttggctgtgccagttggaggttttgtttgtggatgccctgcccactac
tcacttaatgctgacaacaggacttgtagtgctccaactactttcctgctcttcagtcaa
aagagtgccatcaaccgcatggtgattgatgagcagcagagccctgacatcatccttcct
atccacagccttcggaatgtccgggccattgactatgacccactggacaagcaactctat
tggattgactcacgacaaaacatgatccgaaaagcacaggaagatggcagccagggcttt
actgtggttgtgagctcagttccaaatcagaacctagaaatacaaccctatgacctcagc
attgatatttatagccgctacatttactggacttgtgaggccaccaatgtcattaatgta
acaagattagatgggagatcaattggagtggtactaaaaggcgaacaagacagacctcga
gccattgtggtgaacccggagaaagggtatatgtattttaccaatcttcaggaaaggtct
cccaaaattgaacgggccgctttggatggaacagaacgggaggttctctttttcagtggc
ttaagtaaaccgattgcgttagcccttgatagcagattgggcaagctcttttgggcagat
tcagacctccggcgaattgaaagcagtgatctctcaggtgccaaccggatagtattagaa
gactccaatatcttgcagcctgtgggactgactgtgtttgaaaactggctatattggatt
gataagcagcagcaaatgattgaaaaaattgacatgacaggccgagagggtagaaccaaa
gtccaggctcgaattgcccagcttagtgacattcacgcagtgaaagagctgaaccttcag
gaatatagacagcacccttgtgctcaggataatggtggctgttcacatatttgtcttgta
aaaggagatggtactacaaggtgctcttgccccatgcacctggttctgcttcaagacgag
ctatcatgtggagaacccccaacatgttctcctcagcagtttacttgtttcacgggagaa
attgactgtatccctgtggcttggcgctgcgatgggtttactgagtgcgaagaccacagt
gacgaactcaattgtcctgtatgctcagagtcccagttccagtgtgccagtgggcagtgt
attgatggtgccctccgatgcaatggagatgcaaactgccaggataaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagttccgctgttccaacggtcagtgcattgga
aaacataagaaatgtgatcataatgtggactgcagtgacaagtcagatgaactggattgt
tatccaactgaggaaccagctccacaggccaccaacaccgttggttccgttattggagta
attgtcaccatttttgtgtctggaaccatatactttatctgccagagaatgttgtgtcca
cgtatgaagggggatggggaaaccatgactaatgactatgtcgttcatggaccagcttct
gtgccccttggttatgtgccacatccaagttctttgtcaggatctcttccaggaatgtct
cgaggtaaatcaatgatcagctccctaagtatcatggggggaagcagtggacccccttac
gaccgagctcatgtcacaggagcatcatcgagtagttcttcaagtaccaaaggcacttac
ttccccgcaattttgaaccctccaccatccccagccacagagcgatcacattacactatg
gaatttggttattcttcgaatagtccttccactcataggtcctacagctacaggccgtac
agctaccggcactttgcaccccctaccacaccctgcagcacagatgtttgtgacagtgac
tatgctcccagccggagaatgacctcagtggcaacagccaagggctacactagtgacttg
aactatgactcagagcctgtgcccccacctcccacaccccgaagccaatacctgtcagca
gaagagaactatgaaagctgcccaccttctccatacacagagaggagctactctcatcac
ctctacccaccaccgccctctccctgtacagactcctcctga

DBGET integrated database retrieval system