KEGG   Ailuropoda melanoleuca (giant panda): 100474064
Entry
100474064         CDS       T01329                                 

Gene name
PCNA
Definition
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03030  DNA replication
aml03410  Base excision repair
aml03420  Nucleotide excision repair
aml03430  Mismatch repair
aml04110  Cell cycle
aml04530  Tight junction
aml05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100474064 (PCNA)
   03410 Base excision repair
    100474064 (PCNA)
   03420 Nucleotide excision repair
    100474064 (PCNA)
   03430 Mismatch repair
    100474064 (PCNA)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100474064 (PCNA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100474064 (PCNA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100474064 (PCNA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aml03032]
    100474064 (PCNA)
   03400 DNA repair and recombination proteins [BR:aml03400]
    100474064 (PCNA)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    100474064 (PCNA)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100474064 (PCNA)
   MMR (mismatch excision repair)
    Other MMR factors
     100474064 (PCNA)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    100474064 (PCNA)
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Hus1 FmdE
Other DBs
NCBI-GeneID: 100474064
NCBI-ProteinID: XP_002924870
Ensembl: ENSAMEG00000009089
UniProt: D2HQS7
LinkDB
Position
13
AA seq 261 aa
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgttcgaggcgcgcctggtccagggctccatcctgaagaaggtgctggaggcgcttaag
gatctcatcaacgaggcctgctgggacataagctcgagcggcgtaaacctgcagagcatg
gactcctcccacgtctccctggtgcagctcaccctgcgctccgagggcttcgacacgtac
cgctgcgaccgcaacttggccatgggtgtgaacctcaccagcatgtccaaaattctaaaa
tgtgctggcaatgaagacatcattacactaagggctgaagataatgcggacaccctggca
ctagtattcgaagctccgaatcaagaaaaggtttcagattacgaaatgaagttaatggat
ttagatgttgaacagcttggaattccagagcaagagtatagctgtgtagtaaaaatgcct
tctggtgagtttgcacgtatatgccgagatctcagccatattggagatgctgttgtaatt
tcctgtgcaaaagatggagtgaaattttctgcaagtggagaactaggaaatggaaatatt
aagttgtcacaaacaagtaatgtggataaagaggaggaagctgtaaccatagagatgaat
gagccagttcagctgacttttgcactgagatacctgaacttctttacaaaagccactccg
ctctctcctacagtaacactcagtatgtctgcagatgtacccctcgttgtagagtataaa
attgctgacatgggacatttaaaatactacttggctcccaagatcgaggatgaagaagga
tcttag

DBGET integrated database retrieval system