KEGG   Ailuropoda melanoleuca (giant panda): 100475180
Entry
100475180         CDS       T01329                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04152  AMPK signaling pathway
aml04218  Cellular senescence
aml04914  Progesterone-mediated oocyte maturation
aml05161  Hepatitis B
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05203  Viral carcinogenesis
aml05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100475180 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100475180 (CCNA1)
   04218 Cellular senescence
    100475180 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100475180 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475180 (CCNA1)
   05202 Transcriptional misregulation in cancer
    100475180 (CCNA1)
   05203 Viral carcinogenesis
    100475180 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100475180 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100475180 (CCNA1)
   05161 Hepatitis B
    100475180 (CCNA1)
   05169 Epstein-Barr virus infection
    100475180 (CCNA1)
   05165 Human papillomavirus infection
    100475180 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aml03032]
    100475180 (CCNA1)
   03036 Chromosome and associated proteins [BR:aml03036]
    100475180 (CCNA1)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100475180 (CCNA1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100475180 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 100475180
NCBI-ProteinID: XP_011235020
Ensembl: ENSAMEG00000010312
LinkDB
Position
7
AA seq 421 aa
MHCSSSKSGGALAPVPRGPDACQMITRAQLGQDPPQRTVLGVLTENGQYRRTCGQGITTI
RCFSGSENVFPPAGKKVLSDCTVQVPAKQGFDIYMDEPDQGDRDSCTGKEEMAFEDVYEV
DTSTLKSDLHFLLDFNTVSPMVVDSSLHSQSEDASDFGTDVINMTEYAEEIHQYLREAEI
RHRPKAHYMRKQPDITEGMRMILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLVAAAAYCLANYTVNRHFW
PETLAAFTGYSLNEIVPCLSELHKACLDIPHRPQQAIREKYKASKYMHVSLMEPPAVLPL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcattgcagcagctccaagagcggaggcgccctagctccagtgcctcgaggtcctgat
gcctgtcagatgataaccagagcccagctcggccaggatcccccacagagaaccgtgcta
ggggtgctaactgagaatgggcagtacaggaggacctgtggccaggggatcacaacaatc
aggtgtttctctggatcagaaaatgtcttccctccagctggaaagaaagtgctctctgac
tgcacggtccaggtgccagccaagcaaggatttgacatctacatggatgagcctgatcag
ggggacagagacagctgcacagggaaagaggagatggcatttgaggatgtgtatgaggta
gacaccagcacactcaagtcagaccttcacttcctgctggattttaacacagtttctcca
atggtggtagattcatctctccattcccagtctgaagatgcatcagattttggtacagat
gtgataaacatgactgaatatgctgaagaaattcatcagtaccttagagaagctgaaata
agacacaggcccaaagcacactacatgaggaagcaaccagatatcacggaaggcatgaga
atgattctggtggactggcttgttgaggtcggtgaagagtataagcttcgagcagagact
ctctatctggctgtcaacttcctggacaggtttctttcatgcatgtctgttctgagaggg
aaattgcagcttgtaggaacagcagctattcttctggcttcgaaatatgaagaaatatac
ccacctgaagtagacgagtttgtctacataactgatgatacttacacaaaacgccaactg
ctaagaatggaacacttgctcctgaaagttctggcgtttgatctcacagtgccaaccacc
aaccagtttctccttcagtacttaaggagacaaggagtgtgcgtcagaactgagaatctg
gccaagtatgtagcagaactgagtctacttgaagctgacccattcttgaaatatcttcct
tcattggtagctgcagcagcttattgcctggcaaactatactgtgaacaggcacttctgg
ccagaaacccttgctgcatttacaggctattcattaaatgaaattgtgccttgcctgagt
gagctacataaagcatgccttgatataccccatcgacctcaacaagcaattagggagaag
tataaggcttcaaagtacatgcacgtgtctctgatggaaccacctgctgttctccctctg
caataa

KEGG   Ailuropoda melanoleuca (giant panda): 100482271
Entry
100482271         CDS       T01329                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04152  AMPK signaling pathway
aml04218  Cellular senescence
aml04914  Progesterone-mediated oocyte maturation
aml05161  Hepatitis B
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05203  Viral carcinogenesis
aml05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100482271 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100482271 (CCNA2)
   04218 Cellular senescence
    100482271 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100482271 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482271 (CCNA2)
   05202 Transcriptional misregulation in cancer
    100482271 (CCNA2)
   05203 Viral carcinogenesis
    100482271 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100482271 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100482271 (CCNA2)
   05161 Hepatitis B
    100482271 (CCNA2)
   05169 Epstein-Barr virus infection
    100482271 (CCNA2)
   05165 Human papillomavirus infection
    100482271 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aml03032]
    100482271 (CCNA2)
   03036 Chromosome and associated proteins [BR:aml03036]
    100482271 (CCNA2)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100482271 (CCNA2)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100482271 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100482271
NCBI-ProteinID: XP_002923869
Ensembl: ENSAMEG00000006109
UniProt: D2HN58
LinkDB
Position
5
AA seq 432 aa
MLGSSEPGPAAREAGSSLLTLPHTALQEDQENINPEKAAPAQQPRTRAGLAVLKAGNPRV
PAPQQRPKTRRVAPLKDLPINDEHVTVPPWKANSKQPAFTIHVDEGEEETQKRPAESKKT
EHENVLAFNSAITLPGPRKPLVPLDYPMDGSFESPHTMDISIVLEDEKPLSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLAFDLAAPTVNQFLTQYFLHQQSANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAF
HLALYTVTGQSWPESLVQKTGYTLESLKPCLMDLHQTYLRAPQHAQQSIREKYKSSKYHG
VSLLNPPETLNV
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgttgggcagctccgagcccgggcctgcggcccgcgaggcgggctcgtcgctgctaaca
ttgccgcatacggcgctccaagaggaccaggagaacatcaaccccgagaaggcggcgccc
gcccagcagccccggacccgggccgggctggcggtactgaaggccgggaacccgcgcgtt
ccggcgccgcagcagaggcccaagacacgtcgggttgcacctcttaaggatcttcctata
aatgatgaacatgtcactgttcctccctggaaagcaaacagtaaacagcctgcatttacc
attcatgtggatgaaggagaagaagagactcaaaagaggccagctgaatctaaaaaaaca
gagcatgaaaatgtcttagcttttaattcagctattactttacctggaccaagaaaacca
ctggtacctcttgattatccaatggatggtagttttgagtcaccacatactatggacata
tcaattgtattagaagatgaaaagccattgagtgtcaatgaagtcccagactaccatgag
gacattcacacataccttagggaaatggaggttaaatgtaagcctaaagtgggttacatg
aagaaacagccagacatcactaacagtatgagggctatccttgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcacttggctgtgaactacattgat
aggttcctttcatcgatgtctgtgttgagaggaaaacttcagcttgtgggcactgctgct
atgctgttggcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtgtac
attacagatgatacctacaccaagaaacaggtcctgagaatggagcacctagttttgaaa
gtgcttgcttttgacctagctgcaccaacagtaaatcagtttcttacccaatactttctg
caccagcagtctgccaactgcaaagttgaaagtttagcaatgtttttgggagaattaagt
ctgatagatgctgacccctacctaaagtatctgccatcagttattgctgcagcggctttt
catttagcactctacacagtcacaggacagagctggcctgaatctttagttcaaaagact
ggatataccttggaaagtcttaagccttgtctcatggaccttcaccagacctacctcaga
gcaccacagcatgcacaacagtcaataagagaaaagtataaaagttcaaagtatcatggt
gtttctctcctcaacccaccagagacactaaatgtgtaa

DBGET integrated database retrieval system