KEGG   Ailuropoda melanoleuca (giant panda): 100475450
Entry
100475450         CDS       T01329                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03320  PPAR signaling pathway
aml04659  Th17 cell differentiation
aml04919  Thyroid hormone signaling pathway
aml04920  Adipocytokine signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05216  Thyroid cancer
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100475450 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100475450 (RXRG)
   03320 PPAR signaling pathway
    100475450 (RXRG)
   04919 Thyroid hormone signaling pathway
    100475450 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    100475450 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475450 (RXRG)
   05202 Transcriptional misregulation in cancer
    100475450 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    100475450 (RXRG)
   05216 Thyroid cancer
    100475450 (RXRG)
   05222 Small cell lung cancer
    100475450 (RXRG)
   05223 Non-small cell lung cancer
    100475450 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100475450 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:aml03310]
    100475450 (RXRG)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100475450 (RXRG)
Nuclear receptors [BR:aml03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100475450 (RXRG)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 100475450
NCBI-ProteinID: XP_002914218
Ensembl: ENSAMEG00000006616
LinkDB
Position
8
AA seq 463 aa
MYGNYSHFMKFPTGFGGSPGHSGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
PPLNALGSPYRVITSAMGPPSGALAAPPGLNLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGLLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLMYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatgggaattattctcacttcatgaagtttcccacaggctttggcggctcccccggc
cactccggctccacgtccatgagcccatcggcagccttgtccacagggaagccaatggac
agccaccccagctacacggacaccccagtgagtgccccccggaccctgagtgcggtgggg
ccccccctcaatgccttgggttctccataccgagtcatcacatctgccatgggcccgccc
tcgggagcgctggctgcgcctccaggactcaatctggtcgccccgcccagctcccagcta
aatgtggtcaacagtgtcagcatttcagaggacatcaagcccttaccagggcttcctggg
attggaaacatgaactatccatcaaccagccccggtttgctggtgaaacacatctgtgcc
atctgtggggacagatcctcaggaaagcactacggtgtatacagttgtgaaggctgcaaa
gggttcttcaagagaaccataaggaaagacctcatgtacacgtgtcgcgataataaggac
tgcctcattgacaagcgccagaggaaccgctgtcagtactgccgttaccagaagtgcctg
gtgatgggcatgaagagggaagctgtgcaggaagaaaggcagaggagccgggagcgggcc
gagagcgaggcagaatgcgccagtagcggccatgaagatatgcctgtggagcggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctatggtgatatgaacatggagaac
tcgacgaatgaccctgtcaccaacatatgccatgctgctgacaagcagcttttcactctt
gttgaatgggccaagcgcatcccccacttctctgacctcaccttggaggaccaggtcatt
ctgctccgggcagggtggaatgagctgctgattgcctctttctcccaccgctccgtctcc
gtgcaggatggcattctcctggccacgggcttacacgtccaccggagcagcgcccacagc
gccggggtcggctccatcttcgacagggtcctgactgagctggtctccaaaatgaaagac
atgcagatggacaagtcggagctggggtgcctgcgagccatcgtgctgtttaacccagat
gccaaggggctgtccaacccctcggaggtagagactctgcgagagaaggtttatgctacc
cttgaggcctacacaaagcagaagtatccggaacaacctggcaggttcgccaagctgctg
ctgcgcctcccagccctgcgctccatcggcttgaagtgcctggagcacctgttcttcttc
aagctcattggggacacgcccatcgacaccttcctcatggagatgctggagaccccgctg
cagatcacctga

KEGG   Ailuropoda melanoleuca (giant panda): 100475696
Entry
100475696         CDS       T01329                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X2
  KO
K08525  retinoid X receptor beta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03320  PPAR signaling pathway
aml04659  Th17 cell differentiation
aml04919  Thyroid hormone signaling pathway
aml04920  Adipocytokine signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05216  Thyroid cancer
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100475696 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100475696 (RXRB)
   03320 PPAR signaling pathway
    100475696 (RXRB)
   04919 Thyroid hormone signaling pathway
    100475696 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    100475696 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475696 (RXRB)
   05202 Transcriptional misregulation in cancer
    100475696 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100475696 (RXRB)
   05216 Thyroid cancer
    100475696 (RXRB)
   05222 Small cell lung cancer
    100475696 (RXRB)
   05223 Non-small cell lung cancer
    100475696 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100475696 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:aml03310]
    100475696 (RXRB)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100475696 (RXRB)
Nuclear receptors [BR:aml03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100475696 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 100475696
NCBI-ProteinID: XP_002914382
Ensembl: ENSAMEG00000001719
LinkDB
Position
5
AA seq 532 aa
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAGEQQTP
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGAPPPSPPGLPLPPSAASSLGGSGAPPP
PPMPHPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKP
PVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSC
RDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPV
DRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFS
SLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVL
TELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPE
QQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtcttgggctgctcgtccgcccttcctcccccagcggcatgccgcagggcagtgtggg
ccagtgggggtgcgaaaagaaatgcattgtggggtcgcctcccggtggcggcggcgacgg
ccctggctggatcccgcagcggcggcggcggcggcagcagccggagaacaacaaaccccg
gagccggagccgggggaggctggacgggacgggatgggcgacagcgggcgggactcccga
agcccagacagttcctccccgaatccccttccccagggggcccctccgccttctcctcct
gggctacccttaccaccttcagcagcctcatcccttggaggctccggggccccaccccca
cccccgatgccacaccccccactgggctccccattcccggtcatcagctcttccatgggg
tcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagtccccag
attaactcaacagtgtcgctccctgggggtgggtctggcccccctgaagatgtgaagcca
ccagtcttaggggtccggggcctgcactgtccaccccctccaggtggccctggggctggc
aaacggctatgtgcaatctgcggggaccgaagctcaggcaaacactatggggtttacagc
tgtgagggctgcaaaggcttcttcaagcgcaccatccgtaaggacctgacatactcgtgc
cgggacaacaaggactgcaccgtggacaagcgccagcgaaaccgctgtcagtactgccgc
tatcagaagtgcctggccaccggcatgaagagggaggcggtacaggaggaacgtcagcgg
gggaaggacaaggacggggatggggagggggctgggggagcccccgaggagatgcctgtg
gacaggatcctggaggcagagcttgctgtggagcagaagagtgaccagggcgttgagggt
cctgggggaaccgggggtagcggcagcagcccgaatgaccctgtgactaacatctgtcag
gcagctgacaaacaactattcacgcttgttgagtgggcgaagaggatcccacacttttcc
tccttgcctctggatgaccaggtcattttgctacgggcaggctggaatgagctcctcatt
gcttccttctcccaccgatccattgatgtccgagatggtatcctcctcgccacaggtctt
catgtgcaccgcaactcagcccattctgcaggcgtgggagccatctttgatcgggtgctg
acagagctagtgtccaaaatgcgtgacatgaggatggacaagacagagcttggctgcctg
agggcaatcattctgttcaatccagacgccaagggcctctccaaccctagtgaggtggag
gttctgcgggagaaagtgtacgcgtcactggagacctactgcaagcagaagtaccctgag
cagcagggacggtttgccaagttgctgctacgtcttcctgccctcaggtccatcggcctt
aagtgtctagagcatctgtttttcttcaagctcattggagacacccccattgacaccttc
ctcatggagatgcttgaggctccccaccagctggcctga

KEGG   Ailuropoda melanoleuca (giant panda): 100479839
Entry
100479839         CDS       T01329                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha
  KO
K08524  retinoid X receptor alpha
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03320  PPAR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04659  Th17 cell differentiation
aml04919  Thyroid hormone signaling pathway
aml04920  Adipocytokine signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml04932  Non-alcoholic fatty liver disease
aml04976  Bile secretion
aml05160  Hepatitis C
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05216  Thyroid cancer
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100479839 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100479839 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100479839 (RXRA)
   03320 PPAR signaling pathway
    100479839 (RXRA)
   04919 Thyroid hormone signaling pathway
    100479839 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    100479839 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    100479839 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479839 (RXRA)
   05202 Transcriptional misregulation in cancer
    100479839 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    100479839 (RXRA)
   05216 Thyroid cancer
    100479839 (RXRA)
   05222 Small cell lung cancer
    100479839 (RXRA)
   05223 Non-small cell lung cancer
    100479839 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100479839 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100479839 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100479839 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:aml03310]
    100479839 (RXRA)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100479839 (RXRA)
Nuclear receptors [BR:aml03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100479839 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 100479839
NCBI-ProteinID: XP_034520652
Ensembl: ENSAMEG00000011124
LinkDB
Position
7
AA seq 439 aa
MAAPSLHPSLGPGIGSSLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTP
TLGFGTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVDANMGLNPNSPND
PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQMT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggctgccccctccctgcacccctctctggggcccggcatcggctcctcgctcggctcc
ccgggacagctgcattcgcccatcagcaccctgagctcccccatcaacggcatgggccca
cccttctcggtcatcagctcccccatgggcccccactccatgtcagtgcccaccacgcct
accctgggcttcggcaccggcagccctcagctcagctcacccatgaaccccgtcagcagc
agcgaggacatcaagcccccgctgggcctcaatggtgtcctcaaagtcccggcccacccc
tcagggaacatggcgtccttcaccaagcacatctgtgccatctgtggggaccgctcctca
ggcaagcactatggggtgtacagctgcgagggctgcaagggcttcttcaagcggacggtg
cgcaaggacctgacctacacgtgccgggacaacaaggactgcctgattgacaagcgccag
cgcaaccgctgccagtactgccgctaccagaagtgcctggccatgggcatgaagcgggaa
gctgtgcaggaggaacggcagcggggcaaggacaggaacgagaacgaggtggagtccacg
agcagtgccaacgaggacatgccggtggagaagattctggaggcagagctggctgtcgag
cccaagaccgagacgtacgtggacgcaaacatggggctgaacccaaactcgcccaacgac
cccgtcaccaacatctgccaggcagcggacaagcagctcttcacgctggtcgagtgggcc
aagcggattccgcacttctcggagctgcccctggacgaccaggtcatcctactgagggca
ggctggaatgagctgctcatcgcctccttctcccaccggtccatcgccgtgaaggacggg
atcctcctggccaccgggctgcacgtccaccggaacagcgcccacagcgcgggggtgggc
gccatctttgacagggtgttgacggagctcgtgtccaagatgcgggacatgcagatggac
aagacggagctgggctgcctgcgtgccatcgtactcttcaaccccgactccaaggggctc
tcgaacccggccgaggtcgaggcgctgagggagaaggtctacgcgtccctggaggcgtac
tgcaaacacaagtaccccgagcagccgggaaggttcgccaagctgcttctccgcctgccg
gccctgcgctccatcggcctcaagtgcctggaacacctctttttcttcaaactcatcggg
gacacgcccatcgacaccttcctcatggagatgctggaagccccccaccaaatgacttag

DBGET integrated database retrieval system