KEGG   Ailuropoda melanoleuca (giant panda): 100476017
Entry
100476017         CDS       T01329                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X2
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04141  Protein processing in endoplasmic reticulum
aml04151  PI3K-Akt signaling pathway
aml04211  Longevity regulating pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04668  TNF signaling pathway
aml04728  Dopaminergic synapse
aml04911  Insulin secretion
aml04915  Estrogen signaling pathway
aml04918  Thyroid hormone synthesis
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml05020  Prion disease
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100476017 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100476017 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100476017 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100476017 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100476017 (ATF6B)
   04915 Estrogen signaling pathway
    100476017 (ATF6B)
   04926 Relaxin signaling pathway
    100476017 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100476017 (ATF6B)
   04918 Thyroid hormone synthesis
    100476017 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100476017 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100476017 (ATF6B)
   04927 Cortisol synthesis and secretion
    100476017 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100476017 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100476017 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100476017 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100476017 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100476017 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100476017 (ATF6B)
   05031 Amphetamine addiction
    100476017 (ATF6B)
   05034 Alcoholism
    100476017 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100476017 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100476017 (ATF6B)
   05161 Hepatitis B
    100476017 (ATF6B)
   05163 Human cytomegalovirus infection
    100476017 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100476017 (ATF6B)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100476017 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 100476017
NCBI-ProteinID: XP_011235972
Ensembl: ENSAMEG00000002381
LinkDB
Position
5
AA seq 704 aa
MVGGRERKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYTGLDDVAEEQTQLFRCPEQD
VPFGSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPPSQA
SGVGEVLVVKTESLAPPLCLLGDDPTSPFETVQINVGPTSDEASDVQTKVEPVSPSSSIN
SEASLLSAESPTQAFIGEEVLEVKTESPSPQGCLLQDVLGPPLGGVQISMGPSSDGPLGK
ALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQPEGP
APPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEA
RLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCMMVFLLFIAFNFGPVS
ISEPPPAPISPRMSGEQPQPRRHLLEFSMQQPIQGVEPLQGSSLGPEEPQPSTPGRPSFR
NLTAFSGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQ
ERQKSQLRKKSPPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVI
HIKTSTVPPSLRKQPSSTPGNATGGPLPASAAGQAHQPLYLNHP
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggttggggggcgggagagaaagatggcggaactgatgctcctcagcgagattgcggac
ccaacacgttttttcacggacaacttgctgagcccggaggactgggacagcaccttgtac
actggcctggatgatgtggcggaggagcagacgcagctcttccgctgcccagagcaggat
gtcccgtttggcagcagctccctggatgtggggatggatgtcagcccccctgagccgcct
tgggaccccctgcctatcttcccagatcttcaggtgaagtctgagccatcctccccctgc
tcctcttcctccctcagctccgaatcatcccatctttccacagagccccccagccaggct
tctggtgtaggagaggtgctggttgtgaagacagagtccttggcacccccactctgcctc
ctaggagatgacccaacatccccatttgaaactgtccagatcaatgtgggtcccacctct
gatgaagcctcagatgtccagaccaaggtagaacctgtctctccatcttcctccatcaac
tctgaggcttccctgctctcagcggagtcccccacccaggcttttataggagaggaggta
ctggaagtgaagacagagtcaccgtcccctcaagggtgtctcctgcaggatgtcctaggc
cccccacttggaggtgtccagatcagtatgggcccatcctctgatggccccttaggcaaa
gcccttcccacccggaagccacccctgcagcccaaacctgtggtgataaccaccgtcccg
atgccacccagagctgtgcctcccagcaccaccatccttttgcagccccttgtccagcca
cccccagtctccccagttgtcctcatccaaggtgctattcgggtccagcctgaggggccg
gcccccccggctccaaggcctgagaggaagagcattgttccagcccctatgcctgggaac
tcctgcccacctgaagtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaac
cgggagtcggcctgccagtcaaggaggaagaagaaggagtatctgcaggggctggaggct
cggctacaggccgtgctggccgacaaccagcagctccgccgggagaacgctgccctccgg
cggcggctggaggccctgctggctgagaacagcgagctcaagttagggtctggaaacagg
aaggtggtctgcatgatggtcttccttctcttcatcgccttcaactttggacccgtcagc
atcagcgagcctcctccggctcccatctctcctcggatgagcggagagcagcctcagccc
cggagacatttgctggagttctcaatgcaacagccaattcagggagttgaacccctccag
ggttcctccctgggccctgaggagccccagcccagcactccaggccggccaagtttcagg
aacctgacagccttctccgggggtgccaaggagttgctgctgagggacctggaccagctc
ttcctctcctctgactgccggcacttcaaccggaccgagtctctgaggcttgctgatgag
ctgagtggctgggtccagcgccaccagagaggccggcggaagattccccagagagcccag
gagagacagaagtctcagctacggaagaagtcgcctccagttaaggcagtccccacccaa
cccccggggcccccagagagggattctgtgggccagctgcagctgtatcgccacccagac
cgttcgcagccagagttcctggatgcaatcgaccgacgagaagacacgttttatgttgtg
tccttccgaagggaccacttgctgctccctgccatcagccacaacaagacctctcggccc
aagatgtccctggtgatgcctgccatggctcccaatgagaccctgtcaggccggggggcc
ccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagggtgatt
cacatcaagacctccacggtgcccccctcactccgaaaacagccatcctcgaccccgggc
aatgccacaggtggccccttgccagcttcggcagccggccaggcccaccagcctctctac
ctcaatcacccctga

DBGET integrated database retrieval system