KEGG   Ailuropoda melanoleuca (giant panda): 100476930
Entry
100476930         CDS       T01329                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04066  HIF-1 signaling pathway
aml04911  Insulin secretion
aml04919  Thyroid hormone signaling pathway
aml04920  Adipocytokine signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04976  Bile secretion
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05211  Renal cell carcinoma
aml05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100476930 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100476930 (SLC2A1)
   04922 Glucagon signaling pathway
    100476930 (SLC2A1)
   04920 Adipocytokine signaling pathway
    100476930 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    100476930 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    100476930 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100476930 (SLC2A1)
   05230 Central carbon metabolism in cancer
    100476930 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100476930 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100476930 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100476930 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aml02000]
    100476930 (SLC2A1)
Transporters [BR:aml02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   100476930 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    100476930 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF2127 DUF523
Other DBs
NCBI-GeneID: 100476930
NCBI-ProteinID: XP_011235738
Ensembl: ENSAMEG00000002058
LinkDB
Position
2
AA seq 493 aa
MGFFSLQKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWIHRYGECISPA
TLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSSVLMGFSKLGKSF
EMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSI
MGNEDLWPLLLSVIFIPALLQCVLLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTR
DLQEMKEESRQMTREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFE
KAGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLE
KLSWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAFAVAGFSNWTSNFIVG
MCFQYVEQLCGPYVFIIFTALLVLFFIFTYFKVPETKGRTFDEIASGFRQAGASQSDKTP
EELFHPLGADSQV
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgggttttttttctctgcagaagctgacgggccgtctcatgctggccgtgggaggggca
gtgcttggctccctgcagtttggctacaacactggcgtcatcaatgccccccagaaggtg
attgaggagttctacaaccagacatggatccaccgctatggggagtgcatctcgccggct
acgctcaccacactgtggtccctctccgtggccatcttctctgtagggggcatgatcggc
tccttctctgtgggcctttttgttaaccgctttggccggcggaactcaatgctaatgatg
aacctgctggccttcgtgtcctctgtgctcatgggcttctcgaagctgggcaagtccttt
gagatgctgatcctgggccgtttcatcatcggtgtgtactgtggcctgaccacaggcttc
gtgcccatgtacgtgggggaggtgtcccccacggcccttcgcggggccctgggcaccctg
caccagctgggcatcgttgttggcatcctcattgcccaggtgttcggcctggactccatc
atgggcaacgaggacctgtggcccctgctgctgagtgtcatcttcatcccggccctgctg
cagtgcgtgctgctgcccttctgccccgagagcccccgcttcctgcttatcaaccgcaac
gaggagaaccgggccaagagcgtgctgaagaagctgcgtgggacggcggacgtgacccgt
gacctgcaggagatgaaggaggagagtcggcagatgacgcgggagaagaaggtcaccatc
ctggagctgttccgctcgcccgcctaccgccagcccatcctcatcgccgtggtgctgcag
ctgtcccagcagctgtcgggcatcaatgccgttttctattactccacgagcatcttcgag
aaggcgggggtgcagcagcctgtgtatgccaccattggctccggcatcgtcaacacagcc
ttcactgtcgtgtcgctgtttgtggtggagcgagccggccggcggaccctgcacctcatc
ggcctggccggcatggcgggctgtgctgtgctcatgaccatcgcactggcactgctggaa
aagctgtcctggatgtcctatctcagcattgtggccatctttggctttgtggccttcttt
gaagtgggccctggccccatcccatggttcattgtggctgaactcttcagccagggtcct
cgcccagctgcctttgctgttgctggcttctcaaactggacctcaaatttcattgtgggc
atgtgcttccagtatgtcgagcaactgtgcgggccgtacgtcttcatcatcttcaccgcg
ctcctcgttcttttcttcatcttcacttacttcaaagttcctgagaccaaaggccggacc
ttcgatgagattgcttccggcttccggcaggcgggagccagccagagtgacaagacaccc
gaggagctcttccaccccttgggggccgattcccaagtgtga

DBGET integrated database retrieval system