KEGG   Ailuropoda melanoleuca (giant panda): 100479304
Entry
100479304         CDS       T01329                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X1
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04144  Endocytosis
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04350  TGF-beta signaling pathway
aml04371  Apelin signaling pathway
aml04390  Hippo signaling pathway
aml04520  Adherens junction
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04659  Th17 cell differentiation
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05161  Hepatitis B
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05220  Chronic myeloid leukemia
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100479304 (SMAD3)
   04350 TGF-beta signaling pathway
    100479304 (SMAD3)
   04390 Hippo signaling pathway
    100479304 (SMAD3)
   04371 Apelin signaling pathway
    100479304 (SMAD3)
   04068 FoxO signaling pathway
    100479304 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100479304 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    100479304 (SMAD3)
   04218 Cellular senescence
    100479304 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100479304 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100479304 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100479304 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479304 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100479304 (SMAD3)
   05212 Pancreatic cancer
    100479304 (SMAD3)
   05225 Hepatocellular carcinoma
    100479304 (SMAD3)
   05226 Gastric cancer
    100479304 (SMAD3)
   05220 Chronic myeloid leukemia
    100479304 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100479304 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100479304 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100479304 (SMAD3)
   05161 Hepatitis B
    100479304 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1
Other DBs
NCBI-GeneID: 100479304
NCBI-ProteinID: XP_034516669
Ensembl: ENSAMEG00000003318
LinkDB
Position
5
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagacggggcagctggacgaactggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccgcctgcaggtgtcccatcgg
aaggggctcccccatgtcatctactgccgtctgtggcgatggccggacctgcacagccac
catgagctgcgggccatggagctgtgtgagttcgccttcaacatgaagaaggacgaggtc
tgcgtgaatccctaccactatcagagggtagagaccccagttctacctcctgtgctggtc
ccacgccacacagagatcccggccgagttccccccgctggatgactacagccattccatc
cccgagaacactaacttccccgcgggcatcgagccccagagcaatattccagaaaccccg
ccccctggctacctgagtgaagatggtgagaccagcgatcaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacacaataatttggac
ctgcagcctgtcacctactgcgagccggccttctggtgctccatctcctactatgagctg
aaccagcgtgttggggagacattccacgcctcgcagccctccatgaccgtggatggcttc
accgacccctccaactcggagcgcttctgcctggggctgctctccaacgtcaataggaac
gcggccgtggagctcacgcggaggcacatcgggcgcggcgtgcggctgtactacatcgga
ggcgaggtcttcgcggagtgtctcagcgacagcgccatctttgtccagtcgcccaactgt
aaccagcgctacggctggcacccggccaccgtctgcaagatcccgccagggtgcaacctg
aagatcttcaacaaccaggagttcgccgccctcctggcccagtcggtcaaccagggcttc
gaggccgtctaccagctgacgcgcatgtgcaccatccgtatgagcttcgtcaaaggctgg
ggcgcagagtacaggagacagaccgtgaccagcaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system