KEGG   Ailuropoda melanoleuca (giant panda): 100480029
Entry
100480029         CDS       T01329                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04020  Calcium signaling pathway
aml04066  HIF-1 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04510  Focal adhesion
aml04520  Adherens junction
aml04530  Tight junction
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05215  Prostate cancer
aml05219  Bladder cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100480029 (ERBB2)
   04012 ErbB signaling pathway
    100480029 (ERBB2)
   04066 HIF-1 signaling pathway
    100480029 (ERBB2)
   04020 Calcium signaling pathway
    100480029 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100480029 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100480029 (ERBB2)
   04520 Adherens junction
    100480029 (ERBB2)
   04530 Tight junction
    100480029 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480029 (ERBB2)
   05206 MicroRNAs in cancer
    100480029 (ERBB2)
   05205 Proteoglycans in cancer
    100480029 (ERBB2)
   05230 Central carbon metabolism in cancer
    100480029 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100480029 (ERBB2)
   05226 Gastric cancer
    100480029 (ERBB2)
   05219 Bladder cancer
    100480029 (ERBB2)
   05215 Prostate cancer
    100480029 (ERBB2)
   05213 Endometrial cancer
    100480029 (ERBB2)
   05224 Breast cancer
    100480029 (ERBB2)
   05223 Non-small cell lung cancer
    100480029 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100480029 (ERBB2)
   01524 Platinum drug resistance
    100480029 (ERBB2)
   01522 Endocrine resistance
    100480029 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100480029 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100480029 (ERBB2)
   04090 CD molecules [BR:aml04090]
    100480029 (ERBB2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100480029 (ERBB2)
Protein kinases [BR:aml01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100480029 (ERBB2)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100480029 (ERBB2)
CD molecules [BR:aml04090]
 Proteins
  100480029 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like ArsP_1
Other DBs
NCBI-GeneID: 100480029
NCBI-ProteinID: XP_002929401
Ensembl: ENSAMEG00000009949
LinkDB
Position
13
AA seq 1260 aa
MELAAWCRWGLLLALLPSGAAGTQVCTGTDLKLRLPASPETHLDMLRHLYQACQVVQGNL
ELTYLPANASLSFLQDIQEVQGYVLIAHSQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
ELPEGDTSVAGATPGGLRELQLRSLTEILKGGVLIQRNPQLCHQDTILWKDIFHKNNQLA
LTLIDTNRSRACQPCSPACKDPHCWGASSGDCQSLTRTVCAGGCARCKGPKPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSRPCARVCYGLGMEHLREAKAVTSAN
IQEFAGCKKIFGSLAFLPESFEGDPASNTAPLQPEQLRVFEALEEITGYLYISAWPDSLP
NLSVFQNLRVIRGRVLHDGAYSLTLQGLRISWLGLRSLRELGSGLALIHRNARLCFIHTV
PWEQLFRNPHQALLHSANRPEAECVGKGLACYPLCAHGHCWGPGPTQCVNCSQFLRGQEC
VEECRELQGLPREYVKDRYCLPCHPECRPQNGSVTCFGSEADQCVACAHYKDPPSCVARC
PSGVKPDLSFMPIWKFADEEGTCQPCPINCTHSCGDLDERGCPAEQRASPVTSIIAAVVG
ILLAVVMGLVFGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGAGGPAHRRHRSSSTRSGGGELTLGLEPSEEEPPKSPLAPSEG
AGSDVFDGDLGMGAAKGLHSLPPQDLSPLQRYSEDPTVPLPPETDGYVAPLTCSPQPEYV
NQPEVWPQPPSPLEGPLPPPRPAGATLERPKTLSPKTLSPGKNGVVKDVFAFGSAVENPE
YLAPRGRAAPQPHPPPAFSPAFDNLYYWDQDPSERGSPPSTFEGTPTAENPEYLGLDVPV
NT seq 3783 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccctccggagcc
gcgggcacccaagtgtgcaccggcacagacctgaagctgcgtctccccgccagtcccgag
acccacctggatatgctccgccacctctaccaggcctgtcaagtggtacagggtaacttg
gagctcacctacctgcctgccaacgccagcctgtccttcctgcaggatatccaggaggtg
cagggctacgtgctcattgctcacagccaagtgagacaggtcccgctgcagaggctccga
atcgtgcgaggcacccagctctttgaggacaactacgccctggccgtgctggacaatgga
gagctgcccgagggggacacctctgtggcaggggctaccccaggagggctgcgggagctg
cagcttcgaagcctcacagagatcctgaagggaggggtcttgattcagcggaacccacag
ctgtgccaccaggacacgattttgtggaaggacatcttccacaagaacaaccagctggcc
ctcacgctgatagacaccaaccgctctcgggcctgccaaccctgttctccagcctgtaaa
gacccccactgctggggagcaagttctggggactgtcagagcttgacacgaaccgtctgt
gccggcggctgtgcccgctgcaagggcccaaaacccactgactgctgccacgagcagtgc
gcagctggctgcacgggccccaagcactcggactgcctggcctgccttcacttcaaccac
agtggcatctgtgagctgcactgcccagccctggtcacctacaacacggacacgttcgaa
tccatgcccaaccctgagggccgatacaccttcggtgccagctgtgtgaccgcctgtccc
tacaactacctgtccacggacgtggggtcctgcaccctggtctgtcccctgaacaaccaa
gaggtgacggctgaggatggcacccagcggtgtgagaaatgcagcagaccctgtgcccga
gtgtgctacggtctgggcatggagcacctgcgggaggcgaaggcggtcaccagcgccaac
atccaagagttcgccggctgcaagaagatctttgggagcctggcgtttctgccagagagc
ttcgagggagacccagcctccaacactgcccccctacagcctgagcagctcagagtgttc
gaggccctggaggagatcacaggttacctgtatatctcagcgtggccggacagcttgcct
aacctcagtgtcttccagaacctgcgagtaatccggggacgagttctgcatgatggtgcc
tactcgctgaccctgcaagggctgcgcatcagctggctggggctgcgctcactgcgggaa
ctgggcagcgggctggccctcatccaccgcaacgcccgcctctgcttcatccacacggtg
ccctgggagcagctcttccggaacccccaccaagccctgctgcacagtgccaaccggccg
gaggccgagtgcgtgggcaagggcctggcctgctacccgctgtgcgcccatgggcactgc
tggggtccggggcccacccagtgcgtcaactgcagccaattccttcggggccaggagtgt
gtggaggaatgccgagaactgcaggggctaccccgggaatatgtgaaggacagatactgt
ctgccatgccaccctgagtgtcggccccagaatggctcagtgacctgctttgggtcggag
gctgaccagtgtgtggcctgcgcccactacaaggaccctccctcctgcgtggctcgctgc
cccagtggtgtgaaacccgacctctctttcatgcccatttggaagtttgcagatgaggag
ggcacatgccagccgtgccccatcaactgcacccactcctgtggggacctggacgagagg
ggctgccccgccgagcagagagccagccctgtgacatccatcattgccgctgtggtgggc
attctgctggccgtggtcatggggctggtcttcggcatcctgatcaagcgaaggcgacag
aagatccgcaagtacacgatgcggaggctgctgcaggaaactgagctggtggagccgctg
acgcctagcggagcaatgcccaaccaggctcagatgcggatcctgaaagagacagagctg
aggaaggtgaaggtgcttggatccggagcttttggcaccgtctacaagggcatctggatc
cctgatggggaaaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatct
cccaaagccaacaaagaaatcttggacgaagcatacgtgatggctggagtgggctcccca
tatgtgtcccgccttctgggcatctgcctgacgtccacagtgcagctggtgacacagctt
atgccctatggctgcctcttagaccacgtccgagagcatcgtgggcgtctgggctcccag
gacctcctgaactggtgtgtgcagatcgctaaggggatgagctacttggaggacgtccgg
ctcgtgcacagggacctggctgcccggaacgtgctggtcaagagtcccaaccatgtcaag
attacagacttcgggctggctcggttgctggacattgatgagaccgagtaccacgcggat
gggggcaaggtgcccatcaagtggatggcgctggagtccattctccgtcggcggttcacc
caccagagtgatgtgtggagctatggtgtgactgtgtgggaactgatgacttttggggcc
aaaccttacgatgggatcccagcccgagagatccctgacctgctggagaagggggaacgg
ctgccccagccccccatctgcaccatcgacgtctacatgatcatggttaaatgttggatg
atagactctgaatgtcgaccacggttccgggagctggtggccgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaacgaagacctgggccccgccagcccgttg
gacagcaccttctaccgttcgctgctggaagatgacgacatgggggacctggtggatgct
gaggagtacctggtgccccagcaggggttcttctgcccagaccctgcccctggagcgggg
ggcccggcccaccgcaggcaccgcagctcatccaccaggagtggcggtggcgagctgaca
ctgggactggagccctccgaggaagagccccccaagtctccactggccccgtcagagggg
gctggctctgacgtgtttgatggtgacttgggaatgggggcggccaaggggctgcacagc
cttcccccccaggacctgagccctctacagcggtacagcgaggaccctacagtacccctg
ccccctgagactgatggctacgttgcccctctgacctgcagcccccagcctgaatacgtg
aaccagcctgaggtttggccgcagcccccctcacccctagaaggccctctgcctcctcct
cgacctgctggtgccaccctggaaaggcccaagactctgtcccccaagaccctctcccct
ggcaagaatggagtcgtcaaagacgtttttgcctttgggagtgcggtggagaaccctgag
tacttggcaccccggggcagggctgcccctcagccccaccctcctccagccttcagccca
gcctttgacaacctctattactgggaccaggacccatcagagcggggctctccacccagt
acctttgaagggacccctacagcagagaaccctgagtacctgggcctggacgtgccagtg
tga

DBGET integrated database retrieval system