KEGG   Ailuropoda melanoleuca (giant panda): 100480638Help
Entry
100480638         CDS       T01329                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml03440  Homologous recombination
aml04064  NF-kappa B signaling pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04210  Apoptosis
aml04218  Cellular senescence
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05170  Human immunodeficiency virus 1 infection
aml05202  Transcriptional misregulation in cancer
aml05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100480638 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100480638 (ATM)
   04068 FoxO signaling pathway
    100480638 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100480638 (ATM)
   04210 Apoptosis
    100480638 (ATM)
   04115 p53 signaling pathway
    100480638 (ATM)
   04218 Cellular senescence
    100480638 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100480638 (ATM)
   05206 MicroRNAs in cancer
    100480638 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100480638 (ATM)
   05170 Human immunodeficiency virus 1 infection
    100480638 (ATM)
   05165 Human papillomavirus infection
    100480638 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100480638 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100480638 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aml03032]
    100480638 (ATM)
   03400 DNA repair and recombination proteins [BR:aml03400]
    100480638 (ATM)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100480638 (ATM)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100480638 (ATM)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100480638 (ATM)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100480638 (ATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT FATC RYDR_ITPR TAN Uso1_p115_head DUF4602
Motif
Other DBs
NCBI-GeneID: 100480638
NCBI-ProteinID: XP_011235454
Ensembl: ENSAMEG00000016741
LinkDB All DBs
Position
Un
AA seq 2934 aa AA seqDB search
MDTVKDSSNGPVYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYFGLYLKPAQDINR
VLVARIIHAVTKGCCSQTDGLNAKFLDFFSKAIQHARQEKSSAGLNHILAAFIIFLKTLA
VNFRIRVCQLGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYVHHPKGAKTQEKGAYE
SSKWKSILYNLYDLLINEISHIGSRGKYSSGSRNVAVKENLIELMADICHQIFNEDTRSL
EISQSYTTTQRELNDYSTPCKKKKIELGWEVIKDHLQKSQSDFDLVPWLQITTQLISKYP
SSLPNCELSPLLVILYQLLPQHRHGERTPYVLRCLTEVALCQGKKSNLEVSQKSDLLKFW
IKIWSLTFRGISSEQIQAENFGLLGAIIQGSLIEVDREFWKLFTGSACRPSCPAVCCLTL
AMTVCVVPETVKTGVEHSLCEVNRSCSLKELIMKWLLLYHLEDDFEDGTELPPVLHSNFP
HLAVEKILVSLTMKNCKAAMNFLQRVPECEQHQKDQEEPPFSEVEELFLQTTFDKMGFLT
IVKECAVEKHQSTVGFSVHQNLKESLDRYLLGLSEQLLHNYSSETTNAETLIRCSSLLVG
VLGCYCYVGVIAEEEAYRSELFQKAKSLMQCAGESITLFKSKTNEESRIASLRNMMNLCT
SCLCNCTKPSPNKIASRFFLRLLTSKLMNDIADICRSLASFIRKPSDFGEVESLEDEADE
NLMEVEDQSSMTLFSDYPPGSSSDAPMSGDGQSTFGAMNPLAEEHLSKQDLLFLDMLKFL
CVCVTTAQTSPVSFRAADIRRKLLMLIDTSMLDPTKSLHLHMYLLLLKELPGEEYPLPME
EVVELLKPLSNVCSLYRRDQDVCKTLLNHFVHIVRNLCQGDMDAENARDAQGQFLTVIGA
FWHLAKEGKCTFSVRMALVKCLKTLLETDPYSKWAILNVMGKDFPVNEVFPHFLADNHHQ
VSMLAAESINRLFQDMKHRGSSTLWKALPLKLQQTAFENAYLQAQEGMREVSHRAKNPEL
LDEIYNRKSVLLMTIAVVLCCSPVCEKQALFALCKSVKENGLEPHLVKKVLGKVSETFGY
RRLEDFMASHLDYLVLEWLNLQDTEHSLYSFPFILLNYTTVEDFYRSCYKVLIPHLVIRS
RFDEVKSIANQIEEDWKSLLTHCFPKILVNILPYFAYEGTGDSGMAQQRETATKVYDMLK
DENLLGKQIDHLFLSNLPEIVVELLMTLHEPAAAGTSQSTDLCDFSGDLDPAPNPPHFPS
HVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKKHRILKIYH
LFVTLLLKDIKSALGGAWAFVLRDVIYTLIHYINKKPSRFVDVSSRSFSLCCDLLSRVCH
TAVTYCKDALENHLHVIVGTLIPLVDDQMEVQGQVLDLLKYLVIDNKDNENLYMTIKLLD
PFPDHDVFKDLRITQQKIKYSKGPFSLLEEINHFLSVSAYDALPLTRLEGLKDLRRQLAQ
HKDQMAGLMRASKDNPQDGIMVKLIVSLLQLCKMAVNHTGEIEVLEAVGSCLGEVGPVDF
STIALQHSGDTSSTKAPELFKDKELQWTFITLTYLNNTLVEDCVKVRSAAATCLKSILAT
KTGHSFWEIYKTTPDPMLIYLQPFRTSKKKFLEVPRLEKESPLEGLDDMSLWIPQNENHD
IWIKRLTCAFLDSGGTKSEILRLLKPMCEVKTDFCQAVLPYLIHDILLQDTEESWRNLLS
AHIQGFFTNCFRHSSPPSRSTTPANLDSESEHLFRCCVDKKSQRTMLAVVDYMRRQKRPS
LGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKSMEDQDKRSLTFEEASQS
TAISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKLLQPLTRLRTYEHEAMWG
KALVTYDLETAISPSTRQAGIIQALQNLGLCHILSVYLKGLDHENKERCAELQELHYQAA
WRNMQWDHCLSVNKGVEGTNYHESLYNAVQSLRDREFSTFYESLRYARVKEVEELCKGGL
ESVYSLYPTLSRLQAIGELENIGELLARSGTDSRQPSEVYAKWRKHSQLLKDSDFSFQEP
IMALRTVILEILMEKEMENSQKECFRDILTKHLVELSILARTVKNTQLPERAMFQIKQYN
PASCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAENDPDLRLIYAECLRVCG
TWLAETCLENPAVIMQTYLEKAVEVARNYDGESSDELKNGKMKAFLSLARFSDTQYQRIE
NYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALRALKEDRKRF
LCKAVENYISCLLSGEGHDMWIFRLCSLWLENSGVSEVNGMMKIDGMKIPSYKFLPLMYQ
LAARMGTKMMGGLGFHEVLNNLISRIAMDHPHHTLFIILALANANKDEFLTKPEAAGRNR
ITKNAPKQSSPLDEDRTEAANRIIHTIRSRRPQMVRSVEALCDAYIILANLDAAQWRAQR
KGISIPADQPITKLKNLEDVVVPTMEIKVDPTGEYRNLVTIQSFKAEFRLAGGLNLPKII
DCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNMLLQRNTETRKRKLTICTYKVVPLSQ
RSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDFSALHCQKKMMDVQKKSFEEKYKTFMD
VCQKFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQS
AELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRSSQ
ETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDDTELHSTPGGEDQECRRSLSDTDQSF
NKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 8805 nt NT seq  +upstreamnt  +downstreamnt
atggatacagtgaaagattcatctaatggtcccgtttatggagcggattgtagcaacatt
ctgctcaaggacattctctcagtgaggaaatattggtgtgaaatatctcagcaacagtgg
ctagaattgttctctgtgtactttggtctgtaccttaaacctgcacaagacattaataga
gttttagtggctagaataattcatgctgtgaccaaaggatgctgttcacaaaccgatgga
ttaaatgccaaatttttggatttcttttccaaggctattcagcatgcaagacaggagaag
agctctgcaggtctaaatcacatcttagcagcgtttattatcttcctcaagacgttggct
gtaaactttcgaattcgagtgtgtcaattaggagatgaaattcttcctaccttgctttat
atttggacccaacatagacttaacgattccttaaaagaagtaattattgaattatttcaa
ctgcagatttatgtgcatcatccaaagggagctaaaacccaagaaaaaggtgcttatgaa
tcaagtaaatggaaaagtatcttgtataacttatatgatctgctaattaacgagatcagt
catataggaagcagagggaaatattcttcaggatctcgtaatgttgctgtcaaggaaaac
ttgattgagttgatggcagatatttgtcaccagatttttaatgaggatactagatctttg
gagatttctcagtcttacactaccacccaaagagaacttaatgattacagcacgccttgc
aaaaagaagaaaatagaattaggctgggaggtgataaaagatcatcttcagaagtcacag
agtgattttgatcttgtgccttggttacagatcacaacccagttaatatccaaatatcct
tcaagtttacctaactgtgagttgtcaccattactggtgatactataccagcttctgcct
caacatcgacatggggagcgcacgccgtatgtgttacgatgccttacagaagttgcattg
tgtcaagggaagaaatccaacctagaagtctcacagaagtcagatttattgaaattctgg
attaaaatttggtctcttacctttcgtggtataagttctgagcaaatacaagctgaaaac
tttggtttacttggagctataattcaaggcagtttaattgaggttgatagagaattctgg
aagttatttactgggtcagcctgcagaccatcatgtcctgcagtatgctgcttgactctg
gcaatgaccgtctgtgtggttccagaaactgtaaaaacaggagtggagcacagtctgtgt
gaagtaaatagaagttgttctttaaaggaattgataatgaaatggctcttactctatcat
ttagaggatgactttgaagacggtacagagctgcctccagttcttcacagtaattttcct
catcttgcagtggagaaaattcttgtgagtctcactatgaaaaattgtaaagctgcaatg
aattttctccaaagagtgccagaatgtgaacaacaccaaaaagatcaagaagagcctcca
ttctcagaagttgaagaactgtttcttcagacaacttttgacaagatgggttttttaacc
attgtgaaagaatgtgctgtagaaaagcaccagtccaccgtaggcttttctgtccaccag
aacctcaaggaatcactggatcgctatcttctgggattatcagagcagcttttacataac
tactcatctgagactacaaatgcagaaacgcttatccggtgttcaagtcttttggtgggt
gttcttggctgctattgttatgtgggagtaatagctgaagaggaagcatatagatcagaa
ctattccagaaagccaagtctctaatgcagtgtgcgggagaaagtatcactctgttcaaa
agtaagaccaatgaggaatctaggattgcttccctgagaaatatgatgaatctctgtacc
agttgcttgtgtaattgtaccaagcccagtccaaataagattgcatctagatttttccta
cgattgttgacatcaaagctcatgaatgatattgcagatatttgtagaagtttggcgtcc
tttatcagaaagccatctgactttggagaagtagaatcgctggaagatgaggctgatgaa
aatctgatggaggtggaggatcagtcatccatgaccctgttcagtgactaccctcctggc
agctccagtgatgcccccatgtctggagatggccagagtacttttggtgccatgaatcct
ttagctgaagaacatctgtcaaagcaagatctgctctttttagacatgctcaagttcttg
tgtgtgtgcgtaactacagctcagaccagtccagtgtcatttagagcagcggacattcgg
aggaagttgttaatgttaattgatactagcatgctagaccctactaaatccctccaccta
cacatgtatctactgcttttaaaggagcttcctggagaagaatatcctttgcccatggaa
gaggttgttgaacttctaaaaccactctccaatgtgtgttctttgtatcgccgtgaccag
gatgtttgtaaaacacttttaaaccactttgttcatatagtgaggaacctgtgtcaaggg
gatatggatgctgaaaacgcaagggatgctcaagggcagtttctgacagtgattggagca
ttctggcacctagcaaaggaggggaaatgcacattctctgtaagaatggcactagtgaag
tgccttaaaactttgcttgagaccgatccttattcaaaatgggctattcttaatgtaatg
ggaaaagactttcctgtaaacgaagtatttccacattttcttgctgataaccatcatcaa
gttagcatgttggcagcagagtcaatcaacagattattccaggatatgaaacacagaggt
tcgtccacattatggaaagcacttcctttgaagcttcagcaaacagcttttgaaaatgca
tacttgcaagctcaggaaggaatgagagaagtgtcccacagagctaagaaccctgaactt
ttggatgagatttataacagaaaatctgttttactgatgacgatagctgtggttttatgc
tgtagcccagtctgtgaaaaacaggctttgtttgcgctgtgcaagtctgtaaaagagaat
ggattagaacctcaccttgttaaaaaggttttagggaaagtttctgaaacttttggatac
agacgtttagaagactttatggcttctcatttggattatctggttttggaatggctaaat
cttcaagatactgaacatagcttatattcttttccttttattttactaaactatacaacc
gttgaggatttctatagatcatgttacaaggttttgatcccacatctagtgattagaagt
cgttttgatgaggtgaagtccattgctaatcagatcgaagaggattggaaaagtcttcta
acacactgctttccaaagattcttgtaaatattcttccttacttcgcctacgagggtaca
ggagacagtgggatggcacagcagagagagactgctaccaaagtctacgatatgcttaaa
gatgaaaatttactaggaaaacagattgatcatttattccttagtaatttgccggagatc
gttgtggagttattgatgacgttacatgagcccgcagctgcaggcaccagccaaagcacg
gacctgtgtgacttttcaggggatttggatcctgcacctaacccacctcattttccttca
catgtgattaaagcaacgtttgcctacatcagcaattgccataaaaccaagcttaaaagc
attttagaaattctttccaaaagccctgattcctatcagaaaattcttctagccatatgt
gagcaagctgctgagacaaataatgtttataaaaagcacagaattcttaaaatatatcac
ctgtttgttactttattactgaaagatattaaaagtgccttaggaggagcttgggccttt
gttcttcgagatgttatctatactttgattcattatatcaacaaaaagccttctcgtttc
gtggatgtgtcgtcacggagcttctccctgtgttgtgacctgttaagccgggtttgccac
acggcagtcacttactgtaaggacgctctggaaaatcatctccacgtgattgttggcaca
cttataccccttgtggacgatcagatggaggtgcagggacaggtgttggacttgttgaaa
tacttagtgatagataacaaggataatgaaaacctctatatgacaattaaacttttagat
ccttttcctgaccatgatgtctttaaggatttgcgcattactcagcagaaaattaaatac
agtaaaggacccttttcgcttttggaggaaataaatcattttctctctgtgagtgcttat
gatgcccttcccctgacaaggctggaaggcctgaaggatctccgcagacagctagctcag
cataaggaccagatggccggcctcatgagagcatctaaggataacccgcaggacggcata
atggtgaagctcattgtcagcttgttgcagttatgcaagatggcggtgaaccacactggt
gaaatagaagttttagaggctgttggaagctgcctgggagaagtgggtcctgtcgatttc
tccacgatagctctgcagcacagtggagatacgtcttctaccaaggcccctgagttgttt
aaggataaggaacttcagtggaccttcataaccctgacctacctgaataacacgctggta
gaagactgtgtcaaagtgcgatcggctgctgctacctgtttgaaaagcattttagccaca
aagactggacatagtttctgggagatttataagacgacacctgatcccatgctgatctac
ctacagcctttcagaacatcaaaaaaaaagtttttagaagtccccagactggagaaagaa
agtccattagaaggcctggatgatatgagcctgtggattcctcaaaatgaaaatcatgac
atttggataaagaggctgacttgcgcctttttggatagtggaggcacgaaaagtgaaatt
cttcgattattaaagccaatgtgtgaagtgaaaactgacttttgtcaggctgtgcttcca
tacttgattcacgatattttactccaagatacagaggaatcctggagaaatctgctttct
gcgcacattcagggatttttcactaactgtttcagacactcctcaccaccgagccgatcc
acgacccctgccaatttggattcagagtcagagcacctgttccgatgctgtgtggacaaa
aaatcacagagaacgatgcttgctgttgtggactacatgaggagacaaaagagaccttcc
ctaggaacagttttcgatgatgctttctggctggagttgaattatctagaggttgccaag
gtggctcagtcttgtgctgctcactttacggcactgctctacgcagaaatctacgcagat
aagaaaagcatggaagaccaagacaaaagaagtcttacgtttgaagaagcaagccagagt
acagctatttctagtttgagtgaaaaaagtaaagaagaaactggaataagtttgcaggat
ctgctcttagaaatctacagaagtataggagagcccgacagtctgtatggctgtggtgga
gggaaactgctacagcccctcactagactgcgcacatatgaacatgaagcaatgtgggga
aaagccctggtgacatatgaccttgagacggccatatccccatcaacccgccaggcaggg
ataatccaggccttgcagaatttgggactctgccatattctttccgtctatttaaaagga
ctagatcatgaaaataaggagcggtgcgctgagctgcaggagctccactaccaggcagct
tggaggaacatgcagtgggaccactgcctttccgtcaacaaaggtgtggaaggaaccaat
taccacgaatcattgtacaatgctgtgcagtctctgagagatagagaattctccacattt
tacgaaagtctcagatatgccagggtgaaagaagtggaggagctgtgcaagggggggctc
gagtctgtgtactccctgtaccccacactcagcaggctgcaggccattggtgagctcgag
aacatcggggagctgctcgccagatcaggcacggatagtaggcagccctctgaagtatac
gctaagtggcggaaacactcccagcttctcaaagacagtgatttcagttttcaggagccc
atcatggctctccgcacagtcattttggagatcctgatggaaaaggaaatggagaactcc
cagaaagaatgttttagggacattctcaccaagcaccttgtagaactctccatactagcc
cgaactgtcaagaacactcagctccctgaaagggcaatgtttcaaattaaacagtataat
ccagctagttgtggagtctctgagtggcagctggaggaagcccaagtattttgggcaaaa
aaggagcagagtcttgccctgagtattctcaagcagatgatcaagaagttggatgccagt
tgtgcagagaatgatcccgacctaagacttatatacgcagaatgtctgcgagtttgcggc
acctggttagcagaaacttgcctagaaaaccctgcggtcatcatgcagacttatctagaa
aaggcagtggaagttgctagaaattatgatggagaaagcagtgatgagcttaaaaatgga
aaaatgaaagcatttctctcattagcacggttctcggacacgcagtaccagagaattgaa
aactacatgaaatcgtcagagtttgaaaacaagcaggctcttctgaaaagggccaaagaa
gaagtgggccttcttagggaacataaaatccagaccaacagatacacagtaaaggtccag
cgggagctggagctggatgaatgtgcactccgtgcactgaaagaggaccgtaaacgtttc
ctatgtaaagcagttgaaaattacatcagttgcttactgagtggagaaggacacgatatg
tggatattccgtctttgttctctctggcttgaaaattccggagtttccgaagtcaatggc
atgatgaagatcgatggaatgaagattccatcctacaaatttttgccccttatgtaccag
ttggctgctagaatggggaccaaaatgatgggaggcctcggatttcatgaagtcctcaat
aatcttatctctagaattgcaatggatcacccccatcacactttgtttattatactggcc
ttagcaaatgcaaacaaagatgaatttttgaccaaaccagaggcagcaggaaggaacaga
ataactaaaaatgcacctaaacaaagctctccgctcgatgaggatcgaaccgaggctgca
aatagaataatacatactatcagaagtaggagacctcagatggtcagaagtgtggaggcg
ctctgtgatgcttatatcatattagcaaacttagacgctgctcagtggagggctcagaga
aaaggcataagtatcccagcagaccagccaattactaaactgaagaatttagaagatgtc
gttgttccaactatggaaattaaggtggaccctaccggagaatacagaaatctggtgact
atacagtcatttaaagcagaatttcgtttagcaggaggtttaaatttacctaaaataata
gactgtctgggctctgatggcaaggaaaggagacagctcgtcaagggccgtgacgacctg
agacaggacgcggtcatgcagcaggttttccagatgtgtaatatgttactgcagaggaac
acggagaccaggaagaggaaactgaccatctgcacatacaaggtggtcccgctttctcag
cgaagtggagtccttgaatggtgcacaggaactgtccccattggtgagttccttgtgaac
aacgagaacggtgctcataagagatacaggccgaaggacttcagcgcccttcactgccag
aagaaaatgatggatgtacaaaagaagtcttttgaagagaaatataaaacgttcatggat
gtctgccagaaatttcaaccggttttccgttacttctgcatggaaaaattcttggaccca
gctgtttggttcgagaagcgactggcttatactcgcagcgtggctacttcctctatcgtt
ggttacatacttggacttggtgatcgacatgtacagaatatcttgataaatgagcagtct
gcagaacttgtacatatagatttgggagttgcttttgagcagggtaagatcctccctact
cccgaaacggttcctttcagactcaccagagatattgtggatgggatgggcattactggt
gttgaaggtgtcttcagaaggtgctgtgaaaaaaccatggaggttatgagaagctctcag
gaaaccctgctaaccattgtggaggttctcctctacgaccccctgtttgactggaccatg
aatcctctgaaagctctgtatttacagcagaggccggaagatgacactgagctgcactcc
actcccggcggagaggaccaggaatgcagacgcagtctcagtgacaccgaccagagcttc
aacaaagtagcggaacgcgtgttgatgagactacaagagaaactgaaaggagtggaggag
ggaacggtgctcagtgttggggggcaggtgaatctgctcatacagcaagccatggacccc
aaaaatctcagccgacttttcccaggatggaaagcttgggtgtga

DBGET integrated database retrieval system