KEGG   Ailuropoda melanoleuca (giant panda): 100480742
Entry
100480742         CDS       T01329                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor isoform X2
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04360  Axon guidance
aml04510  Focal adhesion
aml04520  Adherens junction
aml05100  Bacterial invasion of epithelial cells
aml05144  Malaria
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05211  Renal cell carcinoma
aml05218  Melanoma
aml05223  Non-small cell lung cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100480742 (MET)
   04014 Ras signaling pathway
    100480742 (MET)
   04015 Rap1 signaling pathway
    100480742 (MET)
   04020 Calcium signaling pathway
    100480742 (MET)
   04151 PI3K-Akt signaling pathway
    100480742 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100480742 (MET)
   04520 Adherens junction
    100480742 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100480742 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480742 (MET)
   05202 Transcriptional misregulation in cancer
    100480742 (MET)
   05206 MicroRNAs in cancer
    100480742 (MET)
   05205 Proteoglycans in cancer
    100480742 (MET)
   05230 Central carbon metabolism in cancer
    100480742 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100480742 (MET)
   05226 Gastric cancer
    100480742 (MET)
   05218 Melanoma
    100480742 (MET)
   05211 Renal cell carcinoma
    100480742 (MET)
   05223 Non-small cell lung cancer
    100480742 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100480742 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    100480742 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100480742 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100480742 (MET)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100480742 (MET)
Protein kinases [BR:aml01001]
 Receptor tyrosine kinases (RTK)
  MET family
   100480742 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Pkinase_fungal Kinase-like Linker_histone Ninjurin PepSY_TM
Other DBs
NCBI-GeneID: 100480742
NCBI-ProteinID: XP_002917462
Ensembl: ENSAMEG00000001314
LinkDB
Position
1
AA seq 1382 aa
MKASAVIAPGILVLLFTLVHKSYGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHKH
HIYLGAVNYIYVLNDKDLQKVAEYKTGPVLEHPDCFPCQDCSHRANLSGGIWEDNINMAL
VIDTYYDDQLISCGSVHRGTCQRHVLPPSNTADIQSEVHCMYSPQADEEPGQCPDCVVSA
LGTKVLISEKDRFINFFVGNTINSSYHPDHLLHSISVRRLKETQDGFKFLTDQSYIDVLP
EFRDSYPIKYVHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTREEVFNILQAAYVSKPGAHLAKQIGANLNDDILYGVFARSKPDSTEPMNR
SAVCAFPIKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRSDEYRTE
FTTALQRVDLFMGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGSSTPHVNF
RLDSHPVSPEAIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPPFVQCG
WCHDKCVLLEECPTGTWTQEICLPTIYEVSPTSAPLEGGTMLTVCGWDFGFRRNNKFDLK
KTKVLLGNDSCTLTLSESTTNMLKCTVGPAVNEHFNISIIIANGRGTAQYSAFSYVDPII
TSISPSYGPKTGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTPTE
FPIKLKIDLANREMNSFSYQEDPIVYAIHPTKSFISGGSTITAVGKNLHSVSVLRMVINV
PEARRNFTVACRHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGIHSKYFDLIYVHNP
VFKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCETIYSDSEAVLCKVPND
LLKLNNELNIEWKQAVSSTVLGKVIVQPDQNFTGLIVGVISISLILLLLLGLFLWLKRRK
QIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
SCRQVQYPLTDLSPMLTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKC
WHPKAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNIDGEG
DT
NT seq 4149 nt   +upstreamnt  +downstreamnt
atgaaggcctctgctgtgattgcacctggcatccttgtacttctgtttaccttggtgcac
aagagctatggggagtgcaaagaggcactagtaaagtctgagatgaatgtgaacatgaag
tatcagcttcccaacttcactgcagaaacacccatccagaatgttgttttacacaagcat
catatttacctcggtgcagttaactatatttacgttttaaatgacaaagaccttcagaaa
gttgctgagtacaagactgggcctgtgctggaacacccagattgtttcccatgtcaggac
tgcagccacagagccaatttatcaggtggcatttgggaagataacatcaacatggctcta
gttattgacacctactatgatgaccaactcattagctgtggcagtgtccacagagggacc
tgccagcgacatgtccttccacccagcaatactgctgatatacagtcggaagttcattgc
atgtactccccacaggcagacgaagagcccggccagtgccctgactgtgtggtgagtgcc
ctgggaaccaaagtcctgatatctgaaaaggatcggttcatcaacttcttcgtgggtaac
accataaattcctcgtaccatccagatcatttattgcattcaatatcagtgagaaggcta
aaggaaacgcaagatggtttcaagtttttgacagaccaatcttatattgacgttctacct
gagttcagagattcctaccctattaaatatgtccacgcctttgaaagcaatcattttatt
tactttttgacagtccaacgagaaactctagatgctcagacttttcacacaagaataatc
aggttctgttctgtagactccggattgcattcctacatggaaatgcctctggagtgtatt
ctcacggaaaaaagaagaaagagatccacaagggaggaagtatttaatattctccaagct
gcatatgtcagtaagcctggggcccaccttgctaagcaaataggtgccaacctgaatgat
gacattctctacggagtgtttgcacgaagcaagccagattctactgaacccatgaatcgt
tctgccgtctgtgcattccctatcaaatatgtcaacgaattcttcaacaagatcgtcaac
aaaaacaatgtgagatgtcttcaacatttttatggacccaaccacgaacactgctttaac
aggacacttttgagaaattcatcaggctgtgaagtgcgcagtgacgaatatcgaacggag
tttaccacagctttgcagcgtgttgacttattcatgggccaattcaaccaagtcctctta
acatctatatctaccttcattaaaggagacctcaccattgctaatcttgggacgtcagag
ggtcgtttcatgcaggttgtggtttctcgatcaggatcgtcaacccctcatgtgaatttt
cgcctggattcccaccctgtgtctccagaagcaattgtggagcaccctttaaaccaaaat
ggctacacactggtcgtcactgggaagaaaatcaccaagatcccactgaatggcttaggc
tgtgaacatttccagtcctgcagtcagtgtctctccgcccctccctttgtgcagtgtggc
tggtgccatgacaaatgtgtgctattggaggaatgccccactggaacatggactcaggag
atctgtctgcctacaatctatgaggtttccccaactagtgcacccttggaaggagggaca
atgctgaccgtatgtggctgggactttggattcaggaggaataataaatttgatttaaag
aaaaccaaagttctccttggaaatgacagctgcaccttgaccttaagtgagagcacaaca
aatatgctgaaatgcacagttggtcctgcagtgaatgagcatttcaatatatccataatt
attgcaaatggtcgagggacagcacaatatagtgcattttcctatgtggatcctataata
acaagtatttctccaagttatggtcctaagactggcggcaccttgcttactttaactgga
aagtacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtacttta
aaaagtgtgtcagatagtattctcgaatgttataccccagctcaaaccactccaactgag
ttccctattaaattgaaaattgacttagccaaccgagagatgaacagcttcagttaccag
gaagaccccattgtctatgcaattcatccaaccaaatcttttattagtggtgggagcaca
ataacagctgttggaaaaaacctgcattcagttagtgtcctgaggatggtaataaatgta
cctgaagcaagaaggaactttacagtggcatgtcgacatcgctctaattcagagataatc
tgctgtacaactccttcactgcaacagctgaatctgcaactccctctgaaaaccaaagcc
tttttcatgttagatgggatccattccaaatactttgatctcatttatgtacataatcct
gtgtttaagccttttgaaaagccagtgatgatctcaataggcaatgaaaatgtactggaa
attaagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaat
aagagctgtgagactatatactcagattctgaagccgttttatgcaaggtccccaatgac
ctgctgaaattgaacaacgagctaaatatagagtggaagcaagcagtttcttcaaccgtc
cttggaaaagtaattgttcaaccagatcagaacttcacaggattgattgttggtgttatc
tcaatatcattaatactcttattattactcgggcttttcctgtggctgaaaaggagaaag
caaattaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcat
ttggataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaa
tctgtagactaccgagctacttttccagaagaccagtttcctaactcatctcagaatgga
tcatgcagacaagttcagtatcctctgacagacctgtcccccatgcttaccagtggggac
tctgatatatccagtccattattgcaaaatactgtccacattgacctcagtgctctaaat
ccagagctggtccaggcagtccagcacgtagtgattgggccgagtagcctaattgtgcat
ttcaatgaagtcataggaagaggacattttgggtgcgtataccatgggactttgctggac
aatgatgacaagaaaattcactgtgctgtgaaatctttgaatcgaatcactgacatagga
gaagtttcccagtttctgactgagggaatcatcatgaaagattttagtcatccaaatgtt
ctctcactcttgggaatctgccttcgaagtgaggggtctccgctggtagtcctaccatac
atgaaacatggagatcttcgaaatttcattaggaatgagactcataacccaactgtaaaa
gatcttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaag
tttgtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcactgtcaag
gttgctgattttggtcttgccagagacatgtatgataaagaatactatagtgtacacaac
aaaacaggtgccaagctgcccgtgaagtggatggctttagaaagtctgcaaactcagaag
tttaccaccaagtcagatgtgtggtcctttggcgtgctcctctgggaactgatgacaaga
ggagcaccaccttatcctgacgtcaacacctttgatataacagtttacttgttgcaaggc
agaaggctcctacaacccgaatactgcccagatcccttatatgaagtgatgctcaaatgc
tggcaccctaaagctgaactgcggccatctttttctgaactggtctccaggatatcagca
atattctctactttcattggagagcactatgtccatgtgaacgctacttatgtgaatgtc
aaatgtgtggctccatacccttctctattgtcatcacaagataacattgatggcgagggg
gacacatga

DBGET integrated database retrieval system