KEGG   Ailuropoda melanoleuca (giant panda): 100480849
Entry
100480849         CDS       T01329                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04014  Ras signaling pathway
aml04390  Hippo signaling pathway
aml04392  Hippo signaling pathway - multiple species
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05219  Bladder cancer
aml05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100480849 (RASSF1)
   04390 Hippo signaling pathway
    100480849 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    100480849 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480849 (RASSF1)
   05206 MicroRNAs in cancer
    100480849 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100480849 (RASSF1)
   05223 Non-small cell lung cancer
    100480849 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF5111 Mst1_SARAH
Other DBs
NCBI-GeneID: 100480849
NCBI-ProteinID: XP_011224906
LinkDB
Position
4
AA seq 295 aa
MRLGRWLEATGARDSGSWRAGAAMGEADAGTPSFEMTWSSTTSSGYCSQEDSDSELEQYF
TARTSLARRPRRDQDEPVEWETPDLSQAEVEQKIKEYNSQINSNLFMSLNKDGSYTGFIK
VQLKLVRPVSVPSSKKPPSLQDARRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREV
IEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSEKALSFVLKE
NDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 888 nt   +upstreamnt  +downstreamnt
atgcgcctggggcggtggttggaggctacgggcgcacgggactcggggagctggcgggcg
ggcgcggcgatgggcgaggcggatgcggggacgccttctttcgagatgacctggagcagc
acaacaagcagtggctactgcagccaggaggactcagactcggagctcgagcagtacttc
acggcgcgtacctcactggcgcgcaggccgcgtcgggaccaggacgagcctgtggagtgg
gagacacctgacctttctcaggctgaggttgaacagaagatcaaggagtacaatagccag
atcaacagcaaccttttcatgagcctgaacaaggatggctcctacacaggcttcatcaaa
gttcaactgaagctggtgcgtcctgtctcagtgccttccagcaagaagccaccctccttg
caggatgccaggcggggcccagggcggggcacagctgtgaagcgccggacctccttctac
ctgcccaaggatgctgtcaagcacctgcatgtgttgtcacgcacgcgggcacgtgaggtc
attgaggccctacttcgcaaattcttggtggtagatgacccccgcaagtttgcactcttt
gagcgggctgaacgccatggccaagtgtacctccggaagctgttggatgatgagcagccc
ctgcggctgcggctccttgcagggcccagcgagaaggccctaagctttgtcctcaaggag
aatgactctggggaggtgaattgggatgcctttagcatgcctgaactacacaacttcctg
cgcatcctacaacgggaggaagaggaacacctccgccagatcctgcaaaagtattcctat
tgccgtcagaagatccaggaggccctgcacgcctgccccctggggtga

DBGET integrated database retrieval system