KEGG   Ailuropoda melanoleuca (giant panda): 100483589
Entry
100483589         CDS       T01329                                 

Gene name
TRADD
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X1
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04064  NF-kappa B signaling pathway
aml04071  Sphingolipid signaling pathway
aml04210  Apoptosis
aml04217  Necroptosis
aml04622  RIG-I-like receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04668  TNF signaling pathway
aml04920  Adipocytokine signaling pathway
aml05132  Salmonella infection
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100483589 (TRADD)
   04064 NF-kappa B signaling pathway
    100483589 (TRADD)
   04668 TNF signaling pathway
    100483589 (TRADD)
   04071 Sphingolipid signaling pathway
    100483589 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100483589 (TRADD)
   04217 Necroptosis
    100483589 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100483589 (TRADD)
   04657 IL-17 signaling pathway
    100483589 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100483589 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100483589 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100483589 (TRADD)
   05152 Tuberculosis
    100483589 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100483589 (TRADD)
   05160 Hepatitis C
    100483589 (TRADD)
   05164 Influenza A
    100483589 (TRADD)
   05162 Measles
    100483589 (TRADD)
   05168 Herpes simplex virus 1 infection
    100483589 (TRADD)
   05163 Human cytomegalovirus infection
    100483589 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100483589 (TRADD)
   05169 Epstein-Barr virus infection
    100483589 (TRADD)
   05165 Human papillomavirus infection
    100483589 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death CARD_2
Other DBs
NCBI-GeneID: 100483589
NCBI-ProteinID: XP_019654400
Ensembl: ENSAMEG00000017232
LinkDB
Position
12
AA seq 388 aa
MSYLLNGPSGLCPEGLAAEDSGREDTAGSIGGGTPGLTGLLGLGHRPCASRTPGSVLVQW
SQAGVGIPAGPRPPGGKMATGPNGLDEWVGSAYLFVECSLDKVVLSDAYAHAQQKVPVYR
ALRTALTESGGSPDVLQILKIHRSEPQLIVQVRFCGRQPCSRFLRAYREGSLRAALQGCL
AAALALPSVPLQLELRASAERLDTLLTDEERCLSCIFAQKPDRLRDEELSELEDALRNLT
CASGSQGGDTEVVPAPSQSLATSLSKEKPPPPPPGQTFLFQGQPIVNRPLSLQDQQTFAR
SVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQR
LVEALEENELTSLAEDLLGLTNPDGSLA
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgtcttacctgctaaacggaccaagtgggctttgcccagagggactggcggcggaggac
agcgggcgggaagacactgctgggagcattgggggcgggacgccggggctgacggggctg
ctcggcctggggcaccgcccctgcgcttcgcgcacacccggaagcgtcctagtccagtgg
agccaggccggcgtgggaatcccggctgggccaaggccgccaggaggcaagatggcgact
gggccaaatgggctcgacgagtgggtgggcagcgcatacctgtttgtggagtgctcgctg
gacaaggtggtcctatctgatgcctacgctcacgcccagcagaaggtgccagtgtacagg
gctctgcggacagcattgacagagagtggcgggagcccggacgtgctgcagatcctcaag
atccaccgcagtgagccgcagctgattgtgcaggtgcgtttctgcgggcgccagccctgc
agccgcttcctccgcgcttaccgcgaggggtcgctgcgcgccgcgctgcaagggtgcttg
gcggcggctctcgccctgccctcggtgccgctgcaactggagctgcgcgcaagcgcggag
cggctggataccttgctgacggatgaggagcgctgtttgagttgcatcttcgcgcagaag
cctgaccggctccgggatgaggaactctctgagttggaggacgcgctccggaatctgaca
tgcgcttcggggagccagggtggcgacacggaggttgttccagcgccctcgcagtccctg
gccacctctctctcaaaggagaagccaccacccccgccacctggccagacttttttgttc
cagggtcagcccatagtgaaccggccgctgagcttgcaggaccagcagacgtttgcccgc
tcagtgggtctcaaatggcgcaaagtggggcgctccctgcagcgaggctgtcgtgctctg
cgggacccggcacttgactcattggcctatgagtatgagcgtgaagggctgtatgagcag
gccttccagctgctgcggcgcttcgtgcaggccgagggccgccgcgccacgctgcagcgc
ctggtagaggcccttgaggagaatgagctcaccagcctggcagaggacttgctgggcctc
acgaatcccgatggcagcctggcctaa

DBGET integrated database retrieval system