KEGG   Ailuropoda melanoleuca (giant panda): 100483990
Entry
100483990         CDS       T01329                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X2
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00220  Arginine biosynthesis
aml00330  Arginine and proline metabolism
aml01100  Metabolic pathways
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04066  HIF-1 signaling pathway
aml04071  Sphingolipid signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04370  VEGF signaling pathway
aml04371  Apelin signaling pathway
aml04611  Platelet activation
aml04915  Estrogen signaling pathway
aml04921  Oxytocin signaling pathway
aml04926  Relaxin signaling pathway
aml04931  Insulin resistance
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100483990 (NOS3)
   00330 Arginine and proline metabolism
    100483990 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100483990 (NOS3)
   04371 Apelin signaling pathway
    100483990 (NOS3)
   04066 HIF-1 signaling pathway
    100483990 (NOS3)
   04020 Calcium signaling pathway
    100483990 (NOS3)
   04071 Sphingolipid signaling pathway
    100483990 (NOS3)
   04022 cGMP-PKG signaling pathway
    100483990 (NOS3)
   04151 PI3K-Akt signaling pathway
    100483990 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100483990 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100483990 (NOS3)
   04921 Oxytocin signaling pathway
    100483990 (NOS3)
   04926 Relaxin signaling pathway
    100483990 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100483990 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100483990 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100483990 (NOS3)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100483990 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 100483990
NCBI-ProteinID: XP_011218395
Ensembl: ENSAMEG00000013904
LinkDB
Position
1
AA seq 1201 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPNSSEPSRAPAPVPPPAPDHSPPLTRP
PDGPRFPRVKNWEVGSIAYDTLSAQSQQDGPCTPRRCLGSLVFPRKLQSRPSQDPPPPEQ
LLSQARDFINQYYSSIKRSGSQAHEQRLQEMEAEIAAKGTYQLRESELVFGAKQAWRNAP
RCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPGRGDFR
IWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPEL
FVLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTEI
GTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIVDHHA
ATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQPDPWKG
SATKGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRLF
RKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPR
PEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCA
FARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKAAARD
IFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATVLSVENLQSSKSTRATILVR
LDTGGQEALQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPGEPVAVEQLEKGSPGGPPP
SWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEESSEQQELESLSQDPRRYEE
WKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHPGEIHLTVAVLAY
RTQDGLGPLHYGVCSTWLSQLKAGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPFR
GFWQERLHDIDSKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFSREPD
SPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDMELDEA
GDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWAFDPPGPDTPS
P
NT seq 3606 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggaacccgggcccccctgcggcctggggctgggc
ctgggcctggggctgtgcggcaagcagggccctgcctccccgaactcctctgagcccagc
agggcaccggcacccgtgcccccaccagcaccggaccacagccccccgctcacccggccc
ccggacgggcccaggttccctcgcgtgaagaactgggaggtggggagcatcgcctatgac
accctgagtgcccagtcacagcaggatgggccctgcacccccagacgctgcctgggctct
ctggtatttccacggaaactgcagagccggccgtctcaggaccctccaccccctgagcag
ctgctgagccaggccagggacttcatcaaccagtactatagctctatcaagagaagcggc
tcccaggcccacgagcagaggcttcaggagatggaagctgagatagcggccaagggcacc
taccagcttcgagagagcgagctggtgttcggggccaagcaggcctggcggaatgctccc
cgctgcgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggattgcagc
tctgcccaggagatgttcacctacatctgcaaccacatcaagtatgccaccaaccggggc
aacctccgctcggccatcacagtgttcccccagcgcgccccaggccgcggagacttccga
atctggaacagccaactggtgcgctacgcgggctacaggcagcaggacggctcggtgcgg
ggggacccagccaacgtggagatcacggagctctgcattcagcatggctggaccccagga
aacggccgctttgacgtgctgcccctactgctccaggccccagatgagcccccagaactc
tttgttctgccccccgagctggtcctcgaggtgcccctggagcaccccacgctggagtgg
tttgcggccttgggcctgcgctggtatgccctcccggcggtgagcaacatgctgctggaa
attgggggactggagttccctgcggcccctttcagcggctggtacatgagcactgagatt
ggcacacggaacctgtgtgaccctcaccgatataacatcctggaggatgtggcggtctgc
atggacttggatacccggacaacttcatccctgtggaaagacaaggccgcagtggagatc
aacttggccgtgctgcacagttaccagctggccaaagtgaccatcgtggaccaccatgct
gccactgcctctttcatgaagcacctggagaacgagcagaaggctagggggggctgccct
gccgactgggcctggatcgtgccccccatctctggcagcctcacccctgtcttccatcag
gagatggtcaactatgtcctgtccccggccttccgctatcagccagacccgtggaagggg
agtgcaaccaagggtgccggcatcaccaggaagaagacctttaaagaagtggccaacgca
gtgaagatctctgcctcactcatgggcactgtgatggcaaagcgagtgaaggcgaccatc
ctgtatggctccgagactggccgggcccagagctacgcacagcagctgggtagactcttc
cggaaggctttcgaccctcgggtcctgtgcatggatgagtacgatgtggtgtccctcgag
catgagacgctggtgttggtggtgaccagcacatttgggaatggtgatcccccagagaat
ggagagagttttgcggcggccctgatggagatgtccggcccctacaacagttcccctcgg
ccagaacagcacaagagttacaaaatccgcttcaacagcgtctcctgctcagacccgctg
gtgtcctcctggaggcggaagagaaaggagtccagtaacacagacagtgcaggggccctg
ggcaccctcaggttctgtgtgttcgggctgggatcgcgggcatacccccacttctgcgcc
tttgctcgtgcggtggacacacggctggaggagctgggtggggagcggctgctgcagctg
ggccaaggagatgagctgtgtggccaggaggaggccttccgtggctgggcccaggccgcc
ttccaggcctcctgtgagactttctgcgtgggagaggatgccaaggccgccgcccgggat
atattcagccccaaacggagctggaagcgccagaggtaccggctgagtgcccaggctgag
ggcctccagctgctgccaggcctgatccacgtgcacagaaggaagatgttccaggctaca
gtcctctcagtggaaaacctgcaaagcagcaagtccacccgggccacgatcctggtgcgc
ctagacactggaggccaggaggcgctgcagtaccagcccggcgaccacataggcatctgc
ccgcccaaccggcctggcctcgtggaggcgctgctgagccgtgtggaggatccgcctcca
ccaggagagccagtggcagtggagcagctggagaagggcagccctggtggcccacccccc
agctgggttcgggacccccggctgcccccatgcacactgcgccaggctctcaccttcttc
ctggacatcacttccccgcccagccctcaactccttcgactgctcagcaccctggctgaa
gagtccagtgaacagcaggagctcgagagcctcagccaggacccgcggcgctacgaggag
tggaagtggttccgctgccccacgctgctggaggtgctggagcagttcccctccgtggca
ctacccgcccccctgctcctcacccagctgcccctgctccagccccggtactactcggtc
agctcagcacccagcgcccacccaggagagatccacctcacggtagccgtgctggcatat
aggacgcaggatggactgggcccccttcattacggagtctgctccacatggctaagccaa
ctgaaggccggagatcctgtaccctgcttcatcaggggggccccctccttccggctgccg
cctgatcccagcttgccctgcattctagtgggccctggcacaggcattgcccccttccgg
ggattttggcaggagcggctgcacgacattgacagcaaagggctgcagcccgcccccatg
actttggtgttcggctgccgatgctcccagctcgaccacctttaccgcgacgaggtgcag
gatgcccagcagcgcggagtttttgggcgcgtcctcaccgccttctcccgggagcccgac
agccctaagacctacgtgcaagacatcctgcggacggagctggctgctgaggtgcaccgc
gtgctgtgcctcgaacggggccacatgtttgtgtgcggcgacgtcaccatggcaaccagc
gtcctgcagacggtgcagcgaatcctagcgacggagggcgacatggagctggacgaggcc
ggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggacattttcgggctc
acactgcgcacgcaggaggtgacaagccgcatacgcacccagagcttttccttgcaggag
cgacatctgcggggcgcagtgccctgggcgttcgacccgccgggcccagacactcccagc
ccctga

DBGET integrated database retrieval system