KEGG   Ailuropoda melanoleuca (giant panda): 100484666
Entry
100484666         CDS       T01329                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100484666 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100484666 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:aml03310]
    100484666 (NR3C1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100484666 (NR3C1)
Nuclear receptors [BR:aml03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100484666 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100484666
NCBI-ProteinID: XP_034512090
Ensembl: ENSAMEG00000010159
LinkDB
Position
3
AA seq 782 aa
MDSKESLSTPSKEEISSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAGASQSDSKQQ
RLLVDFPKGSGSHAQQADLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
QLLEESIANLNRSTSVPENPKSSATAAVSAAPPEREFSKTLSDVSSEQQNVKGQTGTNGG
NVKLCTTDQSTFDIWRKKLQDLEFSSGSPEKEASESPWRPDLLIDENCLLSPLAGEDDPF
LLEGNSNEDCKPLVLPDTKPKIKDNGDLILPSPNSVPLPQVKTEKEDFIELCTPGVIKQE
KLGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIP
PIPVGSESWNRCQGSGDDNLASLGTLNFPGRSVFSNGYSSPGMRPDVSSPPSSSSATTGP
PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPA
CRYRKCLQAGMNLEARKTKKKIKGIQQATPGVSQETSENPANKTIVPATLPQLTPTLVSL
LEVIEPEVLYAGYDSSAPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTL
LQYSWMFLMAFALGWRSYRQSSGCMLCFAPDLIVNEQRMTLPCMYEQCKHMMFVSSELQR
LQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRF
YQLTKLLDSMHDVVENLLNFCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFH
QK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggactccaaggaatcactaagcacccccagtaaagaagaaatctctagcagtgtgctt
ggtcgcgagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtg
aaggtttcggcatcttcaccctcactggctggtgcttctcagtcagattccaagcagcaa
agacttttggttgattttccaaaaggctcaggaagccatgcgcagcaggcggacctgtcc
aaggcagtttcgctctcgatgggattgtatatgggagagacagaaacaaaagtgatggga
aatgacctgggattcccacagcagggccaaatcagcctttcctctggggaaacagacttt
cagcttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttccagagaacccc
aagagctcagcgaccgctgctgtttctgctgcccccccagagagggagttttcaaaaact
ctctctgatgtgtcttcagaacagcaaaatgtgaagggccagactggcaccaacgggggc
aatgttaagttgtgtaccacagaccaaagcacctttgatatttggaggaaaaaactccag
gatttggagttttcttctgggtccccagagaaagaggcgagtgagagtccttggagacca
gacctcttgatagatgaaaactgtttgctttctcctctggcaggagaggatgatccattc
cttttggaaggaaactcgaatgaggactgtaaacctctcgttttaccggacaccaaacct
aaaattaaggataatggagatctgatcttaccaagccccaacagtgtgccactgccccaa
gtgaaaacagaaaaagaagatttcattgaactctgcacccctggggtaattaagcaggag
aaactgggcccagtttactgtcaggcaagcttttctggggcaaatataattggtaataag
atgtctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactatgac
atgaatacagcatccctttctcaacaacaggatcagaagcctatttttaatgtcattcca
ccaattcctgttggttcagaaagttggaataggtgccaaggatctggagatgacaacttg
gcttccttggggactttgaacttcccgggtcgatcggttttttctaacggctattcaagc
cctggaatgagaccagatgtcagctctcctccatccagctcctccgcgacaacgggacca
cctcccaaactctgccttgtgtgctctgacgaagcctcagggtgtcattacggggtcttg
acttgtgggagctgcaaagtattcttcaaaagagcggtggaaggtagacagcacaattat
ctttgtgctggaagaaatgattgtatcattgataagattcgaagaaaaaactgtccagca
tgccgctatcgaaaatgtcttcaagctggaatgaacttggaagctcgaaaaacaaagaaa
aagataaaaggaattcagcaggccactccaggagtgtcacaagaaacttctgaaaaccct
gctaacaaaacaatagttcctgcaacattaccacagctcacccctaccctggtgtccctg
ctggaggtcattgaacctgaggtgttatacgcagggtatgacagctctgccccagattcg
acttggcggatcatgaccacacttaacatgttaggtgggcggcaagtgattgcggcagtg
aaatgggccaaggcgataccaggattcaggaacttacacctggatgaccaaatgacccta
ctgcaatattcatggatgttcctcatggcatttgccctgggctggagatcatatagacaa
tcaagtggatgcatgctgtgttttgctcctgatctgattgttaatgagcagagaatgacc
ctcccctgcatgtatgagcaatgtaaacacatgatgtttgtttcctccgagttacagagg
cttcaggtctcttacgaagagtatctctgtatgaaaaccttactgcttctctcttcagtt
cctaaggaaggtttgaagagccaagagctatttgatgaaattcgaatgacctacatcaaa
gagctaggaaaggccattgtgaagagggaagggaactccagccagaactggcagcgcttt
taccaactgacaaaactcttggactccatgcatgatgtggttgaaaatctccttaacttt
tgcttccaaacatttttggataagaccatgagtattgaattcccagagatgttggctgaa
atcatcaccaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcat
caaaagtga

DBGET integrated database retrieval system