Amycolatopsis mediterranei S699: AMES_4132 Help Entry AMES_4132         CDS       T02190                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amm  Amycolatopsis mediterranei S699 Pathway amm00998   Biosynthesis of various antibiotics amm01100   Metabolic pathways amm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMES_4132   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMES_4132 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFO77668 LinkDB All DBs Position 4601596..4601871 Genome browser AA seq 91 aa AA seqDB search MVATVGDHRAEVTKVVCDTFRLDPALVEPDAPLEELGIDSKGRIKLLAALEIYYGVTIDL DRLDRFTDVGSVAGVLAEALGTRGSSGEALK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggtggcgaccgtgggtgatcaccgcgccgaggtcacgaaggtcgtctgcgacaccttc cggctcgacccggctctcgtcgagcccgacgcgcccctggaggagctgggcatcgactcg aaggggcggatcaagctgctggcggcgctggagatctattacggggtgacgatcgacctg gaccggctggaccggttcaccgacgtgggatccgtggccggggtgctcgcggaagcactg ggaactcgaggatcttcaggagaggcgctgaaatga

DBGET integrated database retrieval system