KEGG   Amycolatopsis mediterranei S699: AMES_7013Help
Entry
AMES_7013         CDS       T02190                                 

Definition
(GenBank) threonine dehydrogenase and related Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:amm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AMES_7013
Enzymes [BR:amm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AMES_7013
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AMES_7013
    1.1.1.-  
     AMES_7013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFO80548
UniProt: G0FKB2
LinkDB All DBs
Position
complement(7872195..7873259)
Genome map
AA seq 354 aa AA seqDB search
MGMRALRWHGRGDLRLDEVEEPGPPGPGQAVVEVAYSGICGTDLHEFRHGPNLIRTGPHP
LTGHEPPVTLGHEFSGRVTALGSPVPGIDVGTRVVVDPCLRCGVCRWCRHGEYHICAKGG
SVGLAADGAFAPYVTVPVEGLVRIPDAVPDDLAALAEPLAVGLHAVRRGTVQPGDNVLIL
GAGPIGIAALFAAKLAGAAGVHVSEPVHARAERAARLGASEVFDPTSADVRREVFLRTGR
VGPDVVIEATGLPSLVELAVTTVRRGGRVVLAGISGGAASLPITQIVPFERTVIGSLGYN
YDIPRVLDLIAEKRFDPGALHTGTYPLSEGLAAFAELDADRGAHLKILLTPKEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgcgggccctgcggtggcacggaagaggggatctgcggctcgacgaagtcgag
gaacccggcccgcccggaccgggtcaggccgtcgtcgaagtcgcctacagcggcatctgc
ggcacggacctgcacgagttccggcacggccccaacctcatccggaccggcccgcacccg
ctgaccgggcacgagccgccggtgaccctgggacacgagttcagcggccgggtgaccgcc
ctgggcagtcccgtgcccgggatcgacgtcggcacgcgcgtggtcgtcgacccctgcctg
cgctgcggggtctgccggtggtgccggcacggcgagtaccacatctgcgcgaagggcggt
tccgtcggattggccgcggacggggcttttgcgccttacgtcaccgtgccggtcgagggg
ctcgtccggatccccgacgccgttccggacgacctggccgcactggccgagccgctggcc
gtcgggctgcacgcggtgcgccgcggcacggtccagccgggggacaacgtcctcatcctg
ggcgcgggaccgatcggcatcgccgcgctgttcgcggccaagctggccggcgcggcgggc
gtccacgtcagcgaaccggtgcacgcgcgagccgagcgtgccgcccggctgggcgcgtcc
gaagtcttcgaccccacctcggccgacgtgcggcgcgaggtgttcctgcgcaccggccga
gtcggcccggacgtcgtgatcgaggcgaccgggctgccgtcgctggtcgagctggcggtc
accacggttcgtcgtggcggacgcgtggtgctcgccgggatcagcggaggagccgcgtca
ctgccgatcacgcagatcgtgccgttcgagcggaccgtgatcggctcactcggctacaac
tacgacatcccccgggtgctggacctgatcgccgagaagcggttcgacccaggtgcgctg
cacaccggcacctatccgctttccgagggtttggccgctttcgccgaactcgacgcggac
cgcggcgcgcacctgaagatcctgctgaccccgaaggagctttga

DBGET integrated database retrieval system