KEGG   Amycolatopsis methanolica: AMETH_2833Help
Entry
AMETH_2833        CDS       T03230                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
amq  Amycolatopsis methanolica
Pathway
amq00250  Alanine, aspartate and glutamate metabolism
amq00280  Valine, leucine and isoleucine degradation
amq00410  beta-Alanine metabolism
amq00640  Propanoate metabolism
amq00650  Butanoate metabolism
amq01100  Metabolic pathways
amq01120  Microbial metabolism in diverse environments
Module
amq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMETH_2833 (gabT)
   00650 Butanoate metabolism
    AMETH_2833 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMETH_2833 (gabT)
   00280 Valine, leucine and isoleucine degradation
    AMETH_2833 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMETH_2833 (gabT)
Enzymes [BR:amq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AMETH_2833 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AMETH_2833 (gabT)
Amino acid related enzymes [BR:amq01007]
 Aminotransferase (transaminase)
  Class III
   AMETH_2833 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIJ22925
UniProt: A0A076MVW0
LinkDB All DBs
Position
complement(2956956..2958311)
Genome map
AA seq 451 aa AA seqDB search
MTGHFRNWDMTTSTGTKIRQQRRLETAIPGPRSRELMARKGAAVAAGVGTTMPVFAAAAG
GGIVVDVDGNHLIDLGSGIAVTTVGASNPRVARAVREQVEAFTHTCFMVTPYEGYVAVAE
ALGRLTPGDHEKRTALFNSGAEAVENAVKIARAHTGRGAVAVFDHAYHGRTNLTMAMTAK
SMPYKHGFGPFAPEVYRAPLSYPFRDGGLSGAEAAGRALDVIEKQVGAANLAAVVIEPIQ
GEGGFVEPAPGFLPALASWCRANGVVFVADEVQTGFARTGDWFACDHEGVVPDLIVTAKG
IAGGLPLSAVTGRAEIMDAVHAGGLGGTYGGNPLACAAALAAIETIEQDGLVARAREIGS
LLESRLRGLDDPRIGDVRGRGGMIAVELVRPDTLDPDAALAKAVAAAAHERGVIVLTCGT
HGNVLRFLPPLTISDDLLHDAMDVLGEALRA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtcacttccgaaactgggacatgaccacgagcacgggcacaaaaatccgccag
cagcggcggctggagacggcgatcccgggaccgcgatcccgcgaactcatggcacgcaag
ggcgccgcggtcgccgcgggggtcggcaccacgatgccggtcttcgcggccgcggcaggc
ggcggcatcgtggtcgacgtcgacggcaaccacctgatcgacctcggctcgggcatcgcg
gtcaccacggtcggcgcgagcaacccgcgggtcgcgcgcgcggtgcgggaacaggtcgag
gcgttcacccacacctgtttcatggtcaccccgtacgaggggtacgtggccgtcgccgag
gcactcggccggctgacgcccggcgatcacgagaagcgcacggcactgttcaactcgggc
gcggaggccgtcgagaacgcggtcaagatcgcgcgggcgcacaccggccgcggcgcggtg
gccgtgttcgaccacgcctaccacggccgcaccaacctgacgatggcgatgaccgcgaag
tccatgccctacaagcacgggttcgggccgttcgcgcccgaggtctaccgcgcgccgctg
tcctacccgttccgcgacggcgggctgtccggggccgaggcggcgggccgggcgctggac
gtgatcgagaagcaggtcggcgcggcgaacctggcggcggtggtgatcgagccgatccag
ggcgagggcgggttcgtcgagcccgcgcccggtttcctgcccgcgctggcctcgtggtgc
cgggcgaacggcgtcgtgttcgtcgccgacgaggtccagaccgggttcgcccgcaccggc
gactggttcgcgtgcgaccacgagggtgtggttccggacctgatcgtgacggcgaagggc
atcgcgggcgggctgccgctgtcggcggtgaccgggcgcgcggaaatcatggacgccgtg
cacgccggcgggctgggcggcacctacggcggcaacccgctcgcgtgcgcggccgcgctg
gccgccatcgagaccatcgagcaggacggactcgtggcccgcgcgcgggagatcggctcg
ctgctggagtcccggctgcgcgggctggacgacccgcggatcggcgacgtgcgcggccgg
ggcgggatgatcgcggtcgagctggtgcggccggacactctcgaccccgacgcggcgctg
gcgaaggcggtcgcggcggcggcgcacgagcgcggggtgatcgtgctgacctgcggcacg
cacggcaacgtcctgcggttcctgccaccgctgacgatcagcgacgacctcctgcacgac
gcgatggacgtgctcggggaggcgctgcgcgcgtag

DBGET integrated database retrieval system