KEGG   Anabaena sp. 90: ANA_C10221Help
Entry
ANA_C10221        CDS       T02341                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
anb  Anabaena sp. 90
Pathway
anb00500  Starch and sucrose metabolism
anb01100  Metabolic pathways
anb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:anb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ANA_C10221
Enzymes [BR:anb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     ANA_C10221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: AFW93028
UniProt: K7WCB8
LinkDB All DBs
Position
chANA01:complement(242501..245065)
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPSRLEPLRKLAYNLHFDWNVESKDLFRRLDPDLWESTHHNPVLMLGT
ISQSRLLEVVEDEGFLAQVDRAARQLEDYLQEYTWYKKQRNQHQKECYAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYLINDFYNM
PLHLERNPDGTELRIAVDYPGRKVYARVWRVQVGTVALYMLDTNIEPNKAYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGYEVTAYHMNEGHAAFSALERIRTLIQEKGLNYRE
ARQVVSSSNIFTTHTPVPAGIDLFAPDKILHYLGYYADIFGLPKEQFLGLGRENTGDLSS
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWQKVPVEDVPIAAITNGVHARSCVSKS
TQELYDRYLGPNWSSAPPDNQLWERMDAIPDEELWRNHERCRLDMVLYVREHLVKHLRDR
GASASDIAQAQEVLDPNVLTIGFARRFATYKRATLWMRDLERIKQILLANKHRKVQFVIA
GKAHPKDIPGKELIRDINHFIREHHLEKQVVFVPNYDIHIARLMVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWAIGHGENYDDPNYQDEIEANALYELL
EKEVIPLFYDHRDGDGLPRPWVAKMKDAIRLNCPFFNTARMVREYAMRAYFPASDRYHTL
TVDNYAPAKELAAWRAKLGEHWFSIKIKDIDVSAASDIEVNQTVAVKAKVDLATLSNDDV
QVELYQGSIDANGDIVNAVPVVMDYQGQDTDNSSVYTANITYTTSGLQGLSLRVLPRNQY
LSSPYEPRLIAWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgcacctttaacgtttctccttcactaccgtccagactagaaccttta
cgaaaactggcgtataatctccattttgattggaatgtagagagcaaagacctatttcgt
cgtttagatcctgatttatgggaatctacccaccataatccagtattgatgctgggaact
attagtcaaagccgactattagaagttgttgaagatgaaggctttttagcgcaagtagac
agagcagcgcggcagttagaagattatttgcaggaatacacttggtataaaaaacaaaga
aatcagcatcagaaggaatgttacgcctatttttctgctgaatttgggttagtagattgc
ttacctgtatattcaggtggtttgggtgtactcgcaggagatcaccttaaatctgcgagt
gatttaggattacctttggtgggtgtgggcttattatatcaacaaggctactttgcccag
tatcttaatgctgatggttggcagcaagaacgctacctcatcaatgatttctataatatg
cccttgcatttggaacggaatcccgatggtacagaactacggattgcggtagattatcct
ggacgcaaggtatatgcgcgggtgtggcgtgtccaggtagggacagtagccctgtatatg
ctcgatactaatattgagcctaacaaggcttatgaccacgatatcaccgatcagttgtat
ggtggtgatatagatatgcgtatccaccaagaaattatgctgggcataggtggtgtgcaa
atgctgaaagccttggggtatgaagtcactgcttaccacatgaatgaaggtcatgcggcc
ttctctgctttagaacgtattcgcactctcattcaagaaaaaggactgaattacagagaa
gctagacaagtagtatcttctagtaatatcttcactacgcatactccagtccccgcaggg
attgacttatttgcccccgacaagatcttgcattatctgggttactatgcagatatcttt
ggtttaccgaaagagcaatttttaggcttgggacgagaaaatactggtgatttgtccagt
cccttcagtatggcggtattagccctgaaaatggcgacgttctccaatggtgtggcacaa
ttgcacggtgttgtttcccggcaaatgttccaaggtttgtggcaaaaagttccagtggaa
gacgtaccaattgctgccattactaacggtgtccatgcccgcagttgtgtaagtaaatct
acgcaagagctatacgatcgctatcttggtccaaattggtcatcagcgccaccggataac
caattgtgggaacgcatggatgcaattcctgatgaagagttatggcggaatcacgaacgc
tgccgtttggatatggtattgtatgttcgagaacatttagttaaacatttgcgcgatcgc
ggtgcttcagcttcggatattgcccaagcccaggaagtgcttgatcctaacgttctcact
attggctttgcccgtcgctttgctacctacaaacgcgctactttatggatgcgtgatttg
gaacgaattaagcagattctacttgctaacaaacaccgcaaagtgcagtttgtgattgcg
gggaaagcccaccccaaagatatccctggtaaggaattaattcgggatattaaccacttt
atccgcgaacaccatttagaaaaacaagtggtgtttgtgcctaactacgatattcacatc
gcccgcttaatggtagcaggttgtgatatctggttaaatactccccgtcgtcctagagaa
gcttcggggacaagtggtatgaaagccgctatgaatggcttacccaatttgagtgttctt
gatggttggtgggatgaagcggactatgttcgcaccggttgggcgataggacatggtgaa
aactatgatgatcctaattatcaagatgagatagaagctaacgctctctatgagttgtta
gagaaggaagttattcccctattctatgatcatcgtgatggtgatggcttacctcgtcct
tgggtggcaaaaatgaaagatgcgattcgcttgaattgtcctttctttaatacagcccgg
atggtgagagaatatgcaatgagagcctatttcccggcgagcgatcgctatcataccctc
accgttgataattatgctcccgctaaggaattagcggcttggagagcaaaattaggtgaa
cactggtttagtatcaaaatcaaggatattgacgtatccgcagcatcagacattgaagtt
aatcaaactgtagcggtcaaagctaaggtagatttagcaactttgagtaatgatgatgtg
caagtagagctatatcaaggttctattgatgccaatggtgatattgtcaatgctgtacct
gtggtaatggattaccaaggacaggatacagataattcaagtgtttataccgcaaatatc
acctacaccacttctggtttgcaaggtttatctttgcgtgtcttacctcgaaatcaatac
ctttctagtccttatgaacccagattaatcgcttgggctgaataa

DBGET integrated database retrieval system