KEGG   Ancylobacter sp. TS-1: GBB76_14635
Entry
GBB76_14635       CDS       T06239                                 

Definition
(GenBank) HAMP domain-containing protein
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
anc  Ancylobacter sp. TS-1
Pathway
anc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:anc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GBB76_14635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:anc01001]
    GBB76_14635
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:anc02022]
    GBB76_14635
Enzymes [BR:anc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     GBB76_14635
Protein kinases [BR:anc01001]
 Histidine kinases
  OmpR family
   GBB76_14635
Two-component system [BR:anc02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   GBB76_14635
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_2
Other DBs
NCBI-ProteinID: QFR34250
UniProt: A0A5P8N0E8
LinkDB
Position
3120161..3121990
AA seq 609 aa
MLDPESTRSAADDDRPDSEAAETTAPSGTARGGLLGALRRARNFVAFKSFSSLTRRIVLL
NLAGMCVLVSGILYLSEFRAGLIDARVQSLLVQGEIIAGAIAASAQVETNAITIDPERLL
ELQAGESYGPGEEGFAPLEFPINPERVAPVLKRLVEPTGTRARIYDRDGALLLDSRSLYS
RGEILRFDMPSPTTPKPNWMERGWNSMKFWFERGDLPLYKELGPNNGKGYLEVVQALQGQ
KASAVQVNARGQVIVSVAVPIQRFRAILGVLLLSTQGGEIDEAVAAERLVIVRVFLVAMA
VMVVLSLLLAGTIAGPVRKLADAAERVRRRTRQRVEIPDFTSRSDEIGHLSGALRDMTDA
LYSRIEAIESFAADVSHELKNPLTSLRSAVETLPLAKSDSSRARLLEVIQHDVRRLDRLI
TDISDASRLDGELQRQEVEPVDLVRLLNTVTGVQNDVMRGDGVTVALAFEPPGTTDEFIV
PGHDSRIGQVINNLIDNARSFSAKGGEVRVICRRSRDAVEIIVDDDGPGIPPHALGRIFE
RFYTDRPEEQGFGQNSGLGLSISRQIVEAHGGRIWAENRPAEPPRKGKAARTAPPKPTGA
RFVVRLPAS
NT seq 1830 nt   +upstreamnt  +downstreamnt
ttgctcgatcccgaatcgacgcgctccgccgccgatgacgatcggccggactcggaggcg
gcagagaccacagcgccctccggcaccgcgcggggcggcctgctcggcgcgttgcggcgg
gcacgcaatttcgttgccttcaagagcttctccagcctcacccgccgcatcgtcctgctc
aacctcgccggcatgtgcgtgctggtgtcgggcatcctctatctctcggaattccgcgcc
gggctgatcgacgcgcgcgtgcagagcctgctggtgcagggcgagatcatcgccggcgcc
atcgccgcctcggcgcaggtcgagaccaacgccatcaccatcgaccccgagcggctgctg
gaacttcaggccggcgagagctacggcccgggcgaggagggcttcgccccgctcgaattc
ccgatcaacccggagcgcgtcgccccggtgctcaagcgcctcgtcgagccgaccggcacc
cgcgcgcgcatctacgaccgcgacggcgcgcttctgctcgattcccgctcactctattcg
cgcggcgagatcctgcgcttcgacatgccctcgccgaccacgcccaagccgaactggatg
gagcgcggctggaacagcatgaagttttggttcgagcgcggtgacctgccgctctacaag
gagctcggccctaataacggcaagggctatctggaggtcgtccaggcgctccagggccag
aaggccagcgcggttcaggtgaatgcgcgcggccaggtcatcgtctcggtcgcggtgccg
atccagcgattccgggccattctcggcgtgctgctgctgtccacccagggcggcgagatc
gacgaggcggtcgccgccgaacgcctcgtcatcgtgcgggtcttcctcgtcgccatggcg
gtgatggtcgttctctcgctgctgctggccggcaccattgccggcccggtgcgcaagctc
gccgacgccgccgagcgggtgcgccggcgcacccgccagcgcgtcgagattcccgacttc
accagccgctccgacgagatcggccacctgtccggcgccctgcgcgacatgacggacgcg
ctctattcgcgcatcgaggcgatcgagagcttcgccgccgacgtctcgcacgaactgaag
aacccgctcacttccctgcgctccgccgtggagacgctgccgctcgccaagtcggacagc
tcgcgcgcgcggttgctggaagtgatccagcacgatgtgcgccggctcgaccgcctcatc
accgacatatccgacgccagccgcctcgacggcgaactgcagcgccaggaggtcgagccg
gtcgatctcgtgcgcctgctcaacaccgtcaccggcgtgcagaacgatgtcatgcgcggg
gacggggtgacggtggcgctggccttcgagccgcccggcacgacggacgagttcatcgtc
cccggccatgattcccgcatcgggcaggtcatcaacaacctgatcgacaatgcccgctcc
ttctccgccaagggcggcgaagtgcgggtgatctgccggcgcagccgcgacgcggtggag
atcatcgtcgacgatgacggtcccggcattccgccgcacgcgctgggccgcatcttcgag
cgcttctacaccgaccgcccggaagagcagggcttcggccagaattccggcctcggcctg
tcgatttcccggcagatcgtcgaggcgcatggcggacgcatctgggcggagaaccgcccg
gcggagcccccccgcaagggcaaggcggcccgcaccgcgccgccgaagccgaccggcgcg
cgcttcgtcgtccgcctgccggcaagctga

DBGET integrated database retrieval system