KEGG   Amphiprion ocellaris (clown anemonefish): 111562815Help
Entry
111562815         CDS       T06018                                 

Gene name
aoc1
Definition
(RefSeq) amiloride-sensitive amine oxidase [copper-containing]
  KO
K11182  diamine oxidase [EC:1.4.3.22]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce00330  Arginine and proline metabolism
aoce00340  Histidine metabolism
aoce00380  Tryptophan metabolism
aoce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    111562815 (aoc1)
   00340 Histidine metabolism
    111562815 (aoc1)
   00380 Tryptophan metabolism
    111562815 (aoc1)
Enzymes [BR:aoce01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     111562815 (aoc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3 DUF1965
Motif
Other DBs
NCBI-GeneID: 111562815
NCBI-ProteinID: XP_023117319
Ensembl: ENSAOCG00000015706
LinkDB All DBs
Position
Unknown
AA seq 742 aa AA seqDB search
MKLLYLLQLVCLAGCSTSRSREWAHHGAPMFADLTVREMKAVRDYLHGIPEMELTSARSK
TLKKNSILLMELHLPKKYEALRALDRGQAKPPRQARVIIQFGNQTKPNITEYIVSPLPSP
KSHIVKTFKGEKPVQFDSRPITAAEYGHIVDILVKISNKAHKLLFETTGGFSFSNCSDRC
LTFSDIAPRGLGPGERRSWIMLQKFVEGYFIHPIGFEVLINHQDLDPEKWTVEKVWYSSR
YFDSVEELVEKYESGKVEKVKLPDHGDDDFFSTYIPRGYSNTPTNIHGPKLVEPQGPRYY
VDHNFVEYAGWSFAYRVRSSAGLQVFDLRFNGERIAYEISLQEAIAFYAGDTPAAMQTKY
IDAGWAMGTSTYELAPGIDCPEIATFVDLYHYFDTDKPVRYRNALCIFEMTTAMPLRRHF
NSNFQGGYNFFAGLENTVLVMRTTSTVYNYDYIWDFLFYLNGVVEVKVSASGYIHATFFT
PNGLHYGTKVYNYVLGNLHTHLIHYKVDLDIAGRENSFETMDLKFVNFTNPWSPKDFVVQ
SKLHRTEHKTERSAAFRFGKKFPRYLHFYNPSEKNKWGHQKGYRIQFNSHAHSVLPRGWR
EENGISWSRYPLAVTRHKDSETTSSSIYAQNDPWEPAVSFEDYIRNNEDIVNQDLVAWVT
VGFLHVPHSEDIPNTATPGNAVGFFLRPFNFFDEDPSLASRSTVIVRPGQDGKPKVQRWT
PEVIGHCVTDKPFFYNGTYAGV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttctctacttgctgcagctggtctgcttggccggctgcagtacttccagatcc
agagagtgggctcatcatggagccccaatgtttgccgacctcacagtacgggagatgaaa
gctgtccgggactacctgcatggtattccagagatggagctcactagcgctcgcagcaaa
actctgaagaagaacagtatccttctaatggaactccatctgccaaagaagtatgaggcc
ctaagagctctggaccgtggacaagccaaaccgccacgccaagctcgagtcatcattcag
tttgggaaccaaaccaagcccaacattactgagtacattgtgagtcctctgccatccccg
aagtctcacatagtgaagacattcaagggggagaagcctgttcagtttgattcaaggccc
attactgctgcagagtatggccatattgttgacatccttgtgaagatctcaaataaagct
cacaagctcctgtttgaaaccacgggaggattttccttctcgaactgctctgaccgctgc
ctgacattctcagacattgccccccgtgggttgggtccaggtgagaggagatcctggatt
atgttgcaaaagtttgtggagggttatttcattcacccaattggatttgaagtactgatc
aaccaccaggacctggacccagaaaaatggactgttgagaaggtctggtacagcagtagg
tattttgacagtgttgaggaactggtagaaaaatatgaatcaggaaaagtggaaaaggtc
aaactgcctgatcacggtgatgatgattttttttccacttacatcccccggggttacagc
aacactcccactaatatccatggaccaaagcttgtggagcctcaggggcctcgctattat
gttgaccacaactttgttgaatatgctggatggtcttttgcctacagagtccgctcatca
gctgggcttcaagtttttgacctgcgttttaatggggaaaggattgcctatgagatcagc
ctccaagaagctattgccttctatgcaggtgatactcccgctgccatgcagacaaagtac
atcgatgcaggctgggcaatgggcacctcaacctatgagttggcacctggaatcgactgt
ccagaaattgcaacctttgttgacctttaccactactttgacacagacaaacctgtgcgc
tacagaaatgctctctgtatttttgagatgaccactgctatgcctctgagaaggcatttc
aactccaactttcaggggggatacaacttcttcgcagggctggaaaacaccgtgttagtg
atgcggacaacctccacagtatacaactatgactacatctgggacttcctcttctacctg
aatggggtggtggaggtaaaggtcagtgcatctggatacatccatgctactttctttaca
cctaacggacttcactatggtacaaaggtgtacaactatgtgctgggtaacctgcacaca
cacctcatccattataaagtggacctggatattgctggtcgagagaacagctttgagacc
atggatctaaaatttgtcaacttcacaaatccatggagcccaaaggatttcgtcgtccaa
tccaaactccacaggaccgaacacaagactgagcgatctgcagcttttcgttttggcaaa
aagttcccccgctatttgcacttttacaaccccagtgagaaaaacaaatgggggcaccag
aagggttatcgtattcagtttaattcacatgctcacagtgtccttccaagaggctggaga
gaggaaaatggcatcagttggtcaagatatcctctggctgtgactcgtcataaagatagt
gaaaccaccagcagcagcatttatgctcagaatgacccatgggaacctgcggtgtccttt
gaggactacatccgcaacaatgaagatatagtcaaccaggacctggtcgcctgggtgacg
gtgggcttcctgcatgtgcctcattcagaagacatccccaacacggcaacacctggcaac
gcagtgggcttcttcctccgaccgttcaatttctttgatgaagatccttctctggcatcc
aggagcaccgtcattgtccggccgggccaggacggcaagcccaaggtccagagatggacg
cctgaggtcatcggtcactgtgtgacagacaagccattcttctacaatggcacttatgca
ggagtctga

DBGET integrated database retrieval system