KEGG   Amphiprion ocellaris (clown anemonefish): 111572796
Entry
111572796         CDS       T06018                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111572796 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111572796 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aoce04052]
    111572796 (kitlg)
Cytokines and growth factors [BR:aoce04052]
 Growth factors
  Growth factors (RTK binding)
   111572796 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 111572796
NCBI-ProteinID: XP_023132384
Ensembl: ENSAOCG00000017230
LinkDB
Position
Unknown
AA seq 269 aa
MKKSKSWIHVCVRFLLFITLGVHSDTLDVNPVTDDISKLYTLKQNIPKDYKIPVRYVPKQ
EGGMCWVKLNVFPLEASLQDLAHKFGNISSNRNDIRIFILILQDLRLKMGSVELIMYDFE
CHYREERWHTERYFDFVKDFLTAAQNKEDSDDCDPPPCPTTPYAVITEEYSKESPTPSSK
GPKCSTDCTAYTEPRYLPEVVERSLLSLLLIPLLALVFLLVWKVRSRRNEEDLQQNPGED
GLFTGTEGTAPPLDADISEKDKLSVIETV
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatacacgtctgtgtccgtttcctgctgttcatcactctt
ggggtgcattcagatacacttgacgtcaacccagtgaccgatgacatctccaaactctat
actttgaagcaaaatattcctaaagattacaaaattcctgtgcgctacgttccaaaacaa
gagggtgggatgtgttgggtgaaattaaatgtcttccctttggaggcaagtttacaagat
ttagcacataagtttggaaacatttcatccaacagaaacgacattaggattttcatccta
atactccaagacctgcggctcaaaatgggttcagtggagttgatcatgtacgattttgag
tgccactacagggaagagaggtggcacacagagcgatactttgactttgtcaaagacttt
cttacagctgcacagaataaagaagattcagatgactgtgatcctcctccctgtcccacg
acaccatatgcagtaataacagaagaatattcaaaagaatcacccactcccagcagtaaa
ggcccaaagtgttcaactgactgcacagcatatacagaaccaagataccttcctgaggtg
gtggagcgaagccttctctccttactgctcattccactcctagccctcgtattcctgctt
gtatggaaggtcagatcacggagaaatgaggaggatcttcaacaaaatcccggagaagat
ggactcttcactggaacagaagggactgcacctccactagatgctgacatatcagaaaaa
gacaagctgagcgtcattgagacagtgtaa

DBGET integrated database retrieval system