KEGG   Amphiprion ocellaris (clown anemonefish): 111585729Help
Entry
111585729         CDS       T06018                                 

Definition
(RefSeq) B-cadherin-like
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04371  Apelin signaling pathway
aoce04514  Cell adhesion molecules (CAMs)
aoce04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111585729
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111585729
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111585729
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aoce03036]
    111585729
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:aoce04515]
    111585729
   04090 CD molecules [BR:aoce04090]
    111585729
Chromosome and associated proteins [BR:aoce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111585729
Cell adhesion molecules [BR:aoce04515]
 Cadherins
  Major cadherins
   111585729
CD molecules [BR:aoce04090]
 Proteins
  111585729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 Big_9
Motif
Other DBs
NCBI-GeneID: 111585729
NCBI-ProteinID: XP_023151088
Ensembl: ENSAOCG00000000425
LinkDB All DBs
Position
Unknown
AA seq 915 aa AA seqDB search
MGTARFAVLGVLIIVFQASAPLTAEETSCVPGFESDMLIFKVTRKYLRSGTRLGKVGVTD
CTDRTRFPLSSDDSRFKVQTDGVLTVNRQVVLHKGQQDFSISSWDSQGRKMTVPVRVVHD
GHHHGNHHGDHHGDHHGDHHGDHHGHHQQNVEHHHGQNHVNNTESATDTQVSILRFPKSG
GGLRRRKRDWVIPDLSVVENDRGPYPLKVSQIRSNEDKIKKIFYSITGPGADQPPAGLFT
MDRTTGILYLTQPLDREKQDKYTFLAHAVAEGAGTAEDPMDIVVNVIDQNDNKPAFAKDT
FVGEVAEASKIGFEVIKVEATDLDQPNTDNSDIRYRIMSQEPQLPSASLFVINPVTGVIR
VNSGGLDREKYPQYTLVVQAADMVGEGLTGQAKVILKVTDSNDNAPVFTQPAYEATVEEN
KVDALIVKMSVTDGDEPHSPAWNAKFKIVDGDPEGLFTVETAINKQEGIISTAKGLDFEK
TSKHTLLVTVENEIPFAISLPTSTATVVVNVEDVNEAPVFDPKEKPVSKPEDLAVDSEVV
QYKAFDPDTARKQKVMYKIISDPAGWLNVAKETGLITVKSLMDRESHFIKDNKYTALIGA
YDDDEVPATGTGTLMIQLEDVNDNAPTIIEREFQVCNKEPAPQLLAVTDKDGPGFAAPYR
VSLDDAMSKANWTARMNETKTGIILNLAKHLESGHYTVVLRVSDTQGMGQINTVHAEVCE
CTGAQTMCQGGRIAGGANLPAILGILGGILLLLMLALLLLLFARRRGGEKKEPLLQDDDI
RDNIYYYDEEGGGEDDQDYDLSVLHRGLDNRPDVFRNDVVPNFMPAPQYRPRPANPDEIG
NFIDDNLKAADNDPTAPPYDSLLVFDYEGGGSDAGSLSSLNSSSSGDQDYDCLNEWGPRF
KKLADMYGGGEDDML
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgctcggttcgcggttttgggcgttctaatcatcgtttttcaggcctcagct
ccactgactgctgaggagacatcatgtgtacctggatttgagtcggatatgttgattttc
aaagtgaccagaaagtacctgaggtcaggcacgagactgggtaaagtgggcgtcactgac
tgcacagaccgcacaagatttcctttgagcagtgatgacagccgcttcaaggttcagaca
gacggcgtattaactgtaaacagacaggttgttcttcataaaggacaacaagattttagc
atatcctcttgggactcacaaggtcgcaaaatgactgttcctgtcagggtagtgcatgat
gggcaccaccatgggaaccaccatggggaccaccatggggaccaccatggggaccaccat
ggggaccaccacggacaccaccagcaaaatgttgagcaccaccatgggcaaaaccacgtt
aataacacagagagtgcaaccgatacacaggtgtctattctgcgtttccccaagtctggt
ggagggctgaggcggaggaagagagattgggttattcctgacctctctgttgttgagaat
gacagaggaccctatcccctcaaagtgtctcagatccgctccaacgaagataaaataaag
aagatcttttacagcatcactggtccaggagctgatcaacctccagctggtctttttact
atggacagaacaactggaattctgtatctcacacaaccacttgacagagagaaacaagat
aaatatacgtttctcgcacatgctgtggcagaaggtgcaggaacagctgaggaccctatg
gatattgttgtcaatgtaattgaccagaatgacaacaagcctgcttttgctaaagacacc
tttgtgggagaagttgctgaggcctcaaaaataggttttgaggtgattaaagttgaggcc
acagatctcgaccagcccaatactgacaactcggatatccgctaccgtataatgagccag
gagccacagttgcccagtgcctccctgtttgtcatcaacccggtcactggagtcatcaga
gtgaattctggggggctagacagagagaaatatccacagtacactctggtggtacaagca
gcagacatggtaggagaaggattgactggacaagcaaaagtcatccttaaagtgacagat
agcaatgacaacgctccagtcttcactcagcccgcttatgaggcaacagttgaagaaaac
aaagtagacgctttgattgtaaaaatgtcagtaactgatggcgacgagccccattcccca
gcctggaatgccaagttcaagattgttgatggtgatcctgaaggcctttttacagtggaa
acggcaataaacaaacaagagggaatcatttctactgccaagggtcttgactttgagaag
accagcaagcacactctgttggttacagtggagaatgagattccttttgctatctcgctg
cctacttccaccgccacagtggtggtaaatgtggaggatgttaatgaagctccagtcttt
gatccaaaagagaagcctgtctcaaaaccagaggaccttgctgtcgacagtgaagtggtg
cagtacaaggcttttgatccagacactgcacgcaaacagaaagtcatgtataaaataatt
agtgaccctgcgggctggctgaatgtggccaaggagacgggcctgatcacagtgaaaagc
ctcatggacagagagtcccactttattaaggacaacaaatacacagcactcattggtgca
tatgatgacgatgaagtcccagccacaggaactggtactctgatgattcagcttgaagat
gtcaatgacaatgcacccaccattatagaacgtgaatttcaggtgtgtaacaaggaacca
gctcctcagctgctggctgtaacagataaagatggaccaggctttgctgctccgtacaga
gtctctctggacgacgccatgtcgaaggccaactggactgcaaggatgaacgagaccaaa
acaggcatcatcctgaatttagccaaacatctggagagtggacactacactgtggtcctg
agggtttcagacacccagggtatggggcagatcaacacggtccatgcagaagtgtgcgag
tgcactggagctcaaacgatgtgtcaaggaggccgtattgcaggtggcgccaacctgcct
gccatcctaggaatacttggtggcatcctgttgctgctgatgctggcattgctactgctg
ctatttgcaagacgaaggggaggagagaagaaggagcctctactgcaagacgatgacata
agggacaatatctattactatgatgaagagggaggtggagaggatgatcaggactatgat
ctgagtgttctccaccgtggtctggacaaccgacccgacgtgttcaggaacgacgtggtg
ccaaatttcatgcctgctcctcagtaccggcctcgccccgccaacccagacgagatcggc
aacttcatcgacgataacctgaaggcagcagacaatgacccgacagcacccccttatgac
tccttgctggtgtttgactatgagggaggcggttctgacgcaggaagcctctcctctctg
aactcgtcaagcagcggggaccaagactacgactgcctcaacgaatgggggccccgcttc
aagaaactggctgacatgtacggaggtggagaagacgacatgctgtaa

DBGET integrated database retrieval system