Alkaliphilus oremlandii: Clos_2523 Help Entry Clos_2523         CDS       T00607                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism aoe  Alkaliphilus oremlandii Pathway aoe02020   Two-component system aoe02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:aoe00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Clos_2523  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Clos_2523  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:aoe02035]     Clos_2523 Bacterial motility proteins [BR:aoe02035]  Flagellar system   Flagellar assembly proteins    Others     Clos_2523 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ABW20054 UniProt:  A8MJS2 LinkDB All DBs Position complement(2730023..2730316) Genome browser AA seq 97 aa AA seqDB search MKIFNHSNVNKAMQIYNNKSTEKLKKSKEVEGPKDEIQLSDKAREYQIAMKAFKSLPETR ENLVNELRNQITQGSYSVSGEEIADKIVASVLIDKKI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagatttttaatcattcaaatgtaaataaagcaatgcaaatatacaataataagtcc actgaaaaattgaaaaaatcaaaggaagtggaagggccaaaggatgaaattcagctttca gataaagcaagggaatatcaaattgcgatgaaggcttttaagagcctgccagaaaccaga gaaaacttggtgaatgaattaagaaatcaaattacccaaggaagctatagtgtatctggt gaagaaattgcagataagattgtagccagtgtattaattgataagaaaatctag

DBGET integrated database retrieval system